Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13a28 Olfactory Receptor

Gene Symbol Or13a28
Organism Mouse
Family 13
Subfamily a
Pseudo No
Location chr7:140637703-140638635 (+)
Aliases Olfr61, IH7, MOR253-1

Sequence information


Nucleotide sequence

ATGATGTTCAGTCCCAACCAGACAGAAGTGACAGAGTTTATACTAGAAGGGTTTTCAGAA
CATGCTACTCTAAGACTTCTCCTGACAGGCTGCTTCCTGTCCCTCTACACAATCGCTCTA
ATGGGCAACATTGTTATCATTGCTTTGGTCACCTCCAGCACTGGGCTCCACAGTCCCATG
TACTTTTTCCTGTGCAACCTGGCCACCATGGACATTGTGTGCACCTCCTCTGTGATTCCT
AAGGCCCTGATTGGCCTAGTGTCTGAAGAAAACACCATCTCCTTCAAAGGATGCATGGCT
CAGCTCTTCTTTCTTCTGTGGTCCTTGTCTTCGGAGCTGCTGCTGCTCACGGTCATGGCC
TATGACCGCTATGTGGCCATCTGCTTTCCCCTGCACTACAGCTCTAGAATGAGCCCACAG
CTCTGTGGGGCCCTGGCCGTGGGTGTATGGTCCATCTGTGCTGTGAATGCATCTGTGCAC
ACTGGCCTGATGACACGGCTGTCATTCTGTGGCCCCAAGGTCATCACCCACTTCTTCTGT
GAGATTCCCCCACTCCTCCTGCTTTCCTGTAGTCCCACATACATTAATAGCGTTATGACA
CTTGTGGCAGATGCCTTTTATGGGTGCATCAACTTTGTGCTAACCTTGTTATCCTATGGC
TGCATCATTGCCAGTGTTCTGCGCATGCGTTCTGCTGAGGGCAAGAGGAAGGCCTTTTCT
ACCTGTTCATCCCACCTCATCGTGGTCTCAGTGTACTACTCATCTGTGTTCTGTGCCTAT
GTCAGTCCTGCCTCCAGCTACAGCCCAGAAAGAAGCAAAGTTACCTCCGTGCTGTACTCG
ATCCTCAGCCCAACCCTGAACCCCCTCATCTATACACTAAGGAACAAGGATGTCAAACTC
GCCCTGGGAAGACTCTTGCCCTTTTTCCCCAAG


Conceptual translation

MMFSPNQTEVTEFILEGFSEHATLRLLLTGCFLSLYTIALMGNIVIIALVTSSTGLHSPM
YFFLCNLATMDIVCTSSVIPKALIGLVSEENTISFKGCMAQLFFLLWSLSSELLLLTVMA
YDRYVAICFPLHYSSRMSPQLCGALAVGVWSICAVNASVHTGLMTRLSFCGPKVITHFFC
EIPPLLLLSCSPTYINSVMTLVADAFYGCINFVLTLLSYGCIIASVLRMRSAEGKRKAFS
TCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSILSPTLNPLIYTLRNKDVKL
ALGRLLPFFPK