Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or13d31-ps Olfactory Receptor

Gene Symbol Or13d31-ps
Organism Rat
Family 13
Subfamily d
Pseudo Yes
Location chr5:59259436-59260249 (-)
Aliases Olr835-ps

Sequence information


Nucleotide sequence

AGCTAAATCCCCAACCCCTGAACTGCTAGTTCTAACAACTGGCTCTGCTTAGGGATTTTT
TTTCCTCTCTGAGAGGTCAAGGAAATCCCAGGTTGCATGAATGTTGCATAAATTTGCATT
AGCAAGCTCCCCGGGGAGGAGTCTTCCTGGTTTGTCCGGTGTTGGCCATCCTTTCCTGGA
TGTGGCCCTCCTAGGCATTGTGGCATTTGATCACCACCTGGCTGTCAGACAACCTGAGGT
ATGGAGCAGAGAGGCCTATCTGCTCAGGTCTGCTGGTCCCTGGGCTATTGGTGCCACTGA
TCCATCATCAAGCACTTCATCTGTCAGGCCCTGACTGTGGTGACATCAGCCTGTGCCGAC
ATCTCCATCAATGTGATCAGCATGGGGGTGGCCAACGTGATCTTCCTGGGGGTCCCAGTC
CTGTTCATCTTTGTCTCCTACATCTTCATCCTCTCCACCATCCTGGGGATCCCCTCTGCT
GAGGGGAGGAAGAAGGCCTTCTCCACCTGCTCTGCCCACCTCACCGTGGTGATTGTCTTC
TATGGCACCATCCTCTTCATGTACGGGAAGCCCAAGTCCAAGGACCCGCTGGGGGCAGAC
AAGCAGGACCTTGCAGACAAGCTCATCTCCCTCTTCTATGGACTTCTGACTCCCATGCTG
AACCTCAGAACTACAGTGAGGGCCTTCATATCTAGGGAGTATTTCTCCCAGTGATGGTGA
CATGGTATGCTATGGTTGTCACCCGTAAAACAGGAAAGATCACACCATCTGCCATTCAAA
AGCCAAGACAGGCCGATCAGATTTATTTCTCACC


Conceptual translation

MLHKFALASSPGRSLPGLSGVGHPFLDVALLGIVAFDHHLAVRQPEVWSR/GLSAQVCW
SLGYWCH*SIIKHFICQALTVVTSACADISINVISMGVANVIFLGVPVLFIFVSYIFILS
TILGIPSAEGRKKAFSTCSAHLTVVIVFYGTILFMYGKPKSKDPLGADKQDLADKLISLF
YGLLTPMLNLRTTVRAFISREYFSQ