Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13l2 Olfactory Receptor

Gene Symbol Or13l2
Organism Mouse
Family 13
Subfamily l
Pseudo No
Location chr3:97410220-97411257 (-)
Aliases Olfr1402, MGC123878, MGC123879, MOR217-1

Sequence information


Nucleotide sequence

ATGACCCTGGTAATTCAGAACCATGTTTGTCAGTATCTTCTGTACATATTTACTCTCGAT
CCTTTGTTCTCTGTAGCAATGACTCCATTTGAAATGACCAATCACACACGTGTCACAGAA
TTCATCTTCCTGGGATTTTCCAACCACCCCAACCTACAGGGTGTCTTCTTCCTGGCCTTC
CTGGCCATTTACCTGACAACTCTCCTGGGGAACACACTCATGATAGTGGCCACCAGGGTC
AGCCCTGCACTCCACACTCCAATGTACTATTTCCTCAGCAACTTGAGCTTCCTGGACATC
TGCTACACATCTACCTCCATTCCAGTCATGCTAGTGAACTTCTTCAGGGAGAAGAAGACC
ATCTCCTTTGAGGGCTGCCTCTCTCAGATCTTCTTCTTTGTGTCATGTGCTGGAACTGAA
TGTGTCTTGTTGGCTGCCATGGCATATGACCGCTATGTGGCCGTTTGTCACCCTCTTCGG
TATCCAGTTCTCATGAGCACAAGGGTCTGTATCAGCTTGGTGACTGGATCCTGGCTCTGT
GGCTTGGTGAATTCTGTGACTCACACAGTATTGACAAGCACACTTACTCTGTGTGGCCCC
AACCAAATCAGCCACTTCCTCTGTGATGTCCCATTGCTCCTGAAGCTCTCCTGCTCAGAC
ACCTCTGTCAATGAATCTGTCCTCCATGTGTCCAGTGCCACTGTTGGCCTGAGTCCCTGC
CTGTTCACTGCAGGCTCCTATATACTGATCATCTCTGCCATCCTGAGGATTCCCTCTACT
CAGGGCAAGAGAAAGGCCTTCTCCACCTGTGCCTCACACCTCACTGTGGTGGTGGTTTTC
TTTGGAACAGCCAACTTCAACTATGTCAGACCCAAGGAAGGCTACTCCCTGGACATGGGC
ATATTAGTGTCTGTGCTCTACTGTGTTGTGACCCCCCTGTTTAATCCCATCATCTACAGC
CTGAGGAACAAGGAGGTCAAAGGTGCGCTGAGAAAACTGACTGGAGTGCCTTCCTTAACA
ATAGCAGTGGCTAGAGAG


Conceptual translation

MTLVIQNHVCQYLLYIFTLDPLFSVAMTPFEMTNHTRVTEFIFLGFSNHPNLQGVFFLAF
LAIYLTTLLGNTLMIVATRVSPALHTPMYYFLSNLSFLDICYTSTSIPVMLVNFFREKKT
ISFEGCLSQIFFFVSCAGTECVLLAAMAYDRYVAVCHPLRYPVLMSTRVCISLVTGSWLC
GLVNSVTHTVLTSTLTLCGPNQISHFLCDVPLLLKLSCSDTSVNESVLHVSSATVGLSPC
LFTAGSYILIISAILRIPSTQGKRKAFSTCASHLTVVVVFFGTANFNYVRPKEGYSLDMG
ILVSVLYCVVTPLFNPIIYSLRNKEVKGALRKLTGVPSLTIAVARE