Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13m2-ps Olfactory Receptor

Gene Symbol Or13m2-ps
Organism Mouse
Family 13
Subfamily m
Pseudo Yes
Location chr6:42800743-42801675 (+)
Aliases Olfr451-ps1, MOR257-6

Sequence information


Nucleotide sequence

ATGGGCAAGGAAAATCAGACATGGGTGAGTGAATTCTTGTTGCTGGGGTTGTCAAGTGAC
TGGTGGACTCAGGTCTCCTTGTTTGTACTGTTCCTGGCCATGTACTTGCTGACTGTCCTG
GGCAACCTACTCATCATCCTCCTCATCACACTGGACAGCAAGCTCCATACGCCCATGTAC
TTCTTCCTCAGCATCCTGTCATTTGTGGACATCTGCTACACCAACAGCACTGTCCCCCAG
ATGCTCGTGCACTTTCTGTCAGCCAGGAAGTCCATCCCGTTTCACAGTTGTGTGATGCAG
CTGTATATCTCCCTAGCAATGGGCAGCACAGAGTTCTTCCTGCTAGGTGCCATGGCCTAT
GACCGCTACGTGGCAGTGTGCTACCCTCTGCACTACATGGTCATCATGCATGGAGGGCTG
TGTCTGGGACTGGCTTCTGCCTGTCTGACTGCTGGTCTCACAAATTCACTAATGCAGACA
CTCATGATCTTCCACTTACCCTTCTGTCGTAAGGTCATCAATCACTTTGCCTGTGAGATG
TTGGCTGTGCTGAGGCTGAGTTGTGTGGACATCTCCCTCAACAAGGTCATGGTAGCCATC
TCAGGATTTCTGGTGATCATGCTCCCTTGTATTCTGGTGCTGTTTTCCTATGCTCACATT
GTTGCTGCCATTCTACGCATTCGCTCTTCCCAAGGATGACGCAAAGCCTTTGGGACTTGT
GCCTCCCATCTCACAGTGGTTTCTATGTGTTTTGGAACAGCCATCTTTACATACATGAGG
CCTGTGGGCAGATCCTCAGCAGGACAGGAGAAGATGGTTGCTCTCTTCTATGCTGTTGTG
ACTCCAATGCTCAATCCACTCATCTACAGCTTGAGGAACAATGATGTGATTGGGGCTTTG
AAAAGAACTTTGGAGAAACTTAAGGAAAAAAAA


Conceptual translation

MGKENQTWVSEFLLLGLSSDWWTQVSLFVLFLAMYLLTVLGNLLIILLITLDSKLHTPMY
FFLSILSFVDICYTNSTVPQMLVHFLSARKSIPFHSCVMQLYISLAMGSTEFFLLGAMAY
DRYVAVCYPLHYMVIMHGGLCLGLASACLTAGLTNSLMQTLMIFHLPFCRKVINHFACEM
LAVLRLSCVDISLNKVMVAISGFLVIMLPCILVLFSYAHIVAAILRIRSSQG*RKAFGTC
ASHLTVVSMCFGTAIFTYMRPVGRSSAGQEKMVALFYAVVTPMLNPLIYSLRNNDVIGAL
KRTLEKLKEKK