Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or13m2 Olfactory Receptor

Gene Symbol Or13m2
Organism Rat
Family 13
Subfamily m
Pseudo No
Location chr4:72292261-72293193 (+)
Aliases Olr809

Sequence information


Nucleotide sequence

ATGGGCAAGAAAAACCAGACATGGGTGAGTGAATTCTTGTTGCTGGGGTTGTCAACTGAC
TGGGGGACTCAGGTCTCCTTGTTTGTACTGTTCCTGGCCATGTACTTGCTGACTGTCCTG
GGGAACCTACTCATCATCATCCTCATCAAGCTGGACAGCAAGCTCCATACGCCCATGTAC
TTCTTCCTCAGCATCCTGTCATTTGTGGACATCTGTTACACCAACAGCACTGTCCCCCAG
ATGCTCGTCCATTTCCTGTCAGCCAGGAAGTCCATCCCATTTCATAGTTGTGTGCTGCAG
CTGTATATCTCCCTAGCAATGGGTAGCACAGAGTTCTTCTTGCTAGGTGCCATGGCTTAT
GACCGCTACGTGGCAGTGTGCCACCCTCTGCACTACATGGTCATTATGCATGGAGGGCTG
TGCCTAAGGTTGGCTTCAGCCTGTCTGACTGCTGGTCTCTCAAATTCACTAATGCAGACA
CTCATGATCTTTCAATTACCCTTCTGTCGTACGGTCATCAATCACTTCGCCTGTGAGATG
CTGGCTGTACTGAGGCTGAGTTGTGTGGACATCTCCCTCAACAAGGTCATGGTAGCCATC
TCAGGATTTCTGGTGATCATGCTTCCTTGTATTCTGGTGCTATTTTCCTATGCTCATATT
GTTGCTGCCATTCTGCGTATTCGCTCTTCCCAGGGACGACGAAAAGCCTTTGGGACTTGT
GCCTCCCACCTCACAGTGGTTTCTATGTGCTTTGGAACAGCCATCTTTACATACATGAGG
CCTGTGGGCAGATCCTCAGCAGGACAAGAGAAGATGGTTGCTCTCTTCTATGCTGTTGTG
ACGCCAATGCTCAATCCCCTCATCTACAGCTTGAGAAACAATGATGTGATTGGGGCTTTG
AAAAGAACTTTGGAGAAACTTAAGGAAAACAAA


Conceptual translation

MGKKNQTWVSEFLLLGLSTDWGTQVSLFVLFLAMYLLTVLGNLLIIILIKLDSKLHTPMY
FFLSILSFVDICYTNSTVPQMLVHFLSARKSIPFHSCVLQLYISLAMGSTEFFLLGAMAY
DRYVAVCHPLHYMVIMHGGLCLRLASACLTAGLSNSLMQTLMIFQLPFCRTVINHFACEM
LAVLRLSCVDISLNKVMVAISGFLVIMLPCILVLFSYAHIVAAILRIRSSQGRRKAFGTC
ASHLTVVSMCFGTAIFTYMRPVGRSSAGQEKMVALFYAVVTPMLNPLIYSLRNNDVIGAL
KRTLEKLKENK