Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13n4 Olfactory Receptor

Gene Symbol Or13n4
Organism Mouse
Family 13
Subfamily n
Pseudo No
Location chr7:106823571-106824524 (-)
Aliases Olfr702, MOR260-4

Sequence information


Nucleotide sequence

ATGGGAGGAGGAAACCAAACTTATATTGTAGAATTTATTCTACTGGGACTCTCAGAGAAT
CCTAAAGTACAAATCTTATTATTCTGTATTTTCCTGATCATCTATTTCCTTTCTGTATTT
GGAAACCTGGTCATTATAATCCTCATCCAAATTGACTCTCGACTTCATACACCCATGTAC
TTTTTCCTCAAAAACTTATCCTTTGCTGACCTCTGCTTCTCTACAAGCATTGTACCCCAG
ATGCTGGTCCACTTCCTTTCAAAAAGGAAAACCATTTCCTTTATTGGATGTTCAATACAG
ATAGTTGTCTTTCTCCTAGCAGGGTGCACAGAGTGTGCTCTGCTGGCAGTTATGTCCTAT
GACCGGTATGTTGCTGTCTGCAAACCCTTGCACTACTCCACCATTATGACCCAGAGGGTT
TGTTGCCAGTTGGCTATAGTTTCCTGGATCAGTGGGGCATTTGCATGTTCAGTGGACAGT
GCATTTACACTGTGTATCCCTTATCAGGGACAGAATGTAATTAATCATTACTTCTGTGAA
CCCCCTGCCCTCCTAAAGCTGGCTTCAGCTGACACCTATAATGCTGAAATGGCTCTGTTT
TTAGTGGGGGTGATTATTCTATTAGCTCCTGTCTCACTCATCCTTGTCTCCTATGGGAAC
ATCATCTCCACTGTGATCCGGATGCAGTCAAGGGAGGGAAGGCTCAAGGTCTTTTCAACC
TGTGGGTCCCACCTCACTGTTGTGGTCCTCTACTATGGGTCTGGAATATTTGCCTACATG
AGACCCAACTCCAAGACAATGAGTGAAAAGGATAAGGTTGTCTCTGTGTTCTACTCAGTT
ATGACTTCCATGTTGAATCCAATCATTTACAGCCTCAGAAACAAAGATGTGAAAGGTGCT
CTTGGGAAGCTGGTTGGAAGACTGAGCACGGTCAAGGGCGGTGCTGCAGAAATG


Conceptual translation

MGGGNQTYIVEFILLGLSENPKVQILLFCIFLIIYFLSVFGNLVIIILIQIDSRLHTPMY
FFLKNLSFADLCFSTSIVPQMLVHFLSKRKTISFIGCSIQIVVFLLAGCTECALLAVMSY
DRYVAVCKPLHYSTIMTQRVCCQLAIVSWISGAFACSVDSAFTLCIPYQGQNVINHYFCE
PPALLKLASADTYNAEMALFLVGVIILLAPVSLILVSYGNIISTVIRMQSREGRLKVFST
CGSHLTVVVLYYGSGIFAYMRPNSKTMSEKDKVVSVFYSVMTSMLNPIIYSLRNKDVKGA
LGKLVGRLSTVKGGAAEM