Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or13p10 Olfactory Receptor

Gene Symbol Or13p10
Organism Rat
Family 13
Subfamily p
Pseudo No
Location chr5:137497581-137498525 (+)
Aliases Olr855

Sequence information


Nucleotide sequence

ATGCAGGACTTCCTCTGGAGAAACCGCAGCTCTCTTACAGAGTTTGTCCTTCTAGGATTC
TCTAGTGACACACGGATAAATGGCACTCTGTTTGGTGTCTTTCTTCTCCTCTACCTCAGC
ACCCTCCTAGGCAATGGGCTCATCATCACCTTGATACACATGGATTCACGCCTCCATACA
CCCATGTACTTTTTCCTCAGCATCTTATCCATTCTGGATATGGGCTATGTCACCACCACA
GTGCCTCAGATGCTGGTACATCTGGTCTGTGAAAAGAAGACCATCTCCTATGTTGGATGC
GTGGCTCAGATGTATATCTTCCTGATGCTGGGAATCACCGAGTCTTGGCTTTTTGCAATC
ATGGCTTATGATAGGTATGTGGCCATCTGCCATCCTCTCAGATACAAAGTCATCATGAGC
CCTTTGCTGCGTGGGTCACTGGTGGCCTTCTGTGGGTTCTGGGGTATCACCTGTGCCCTG
ATATATACTGTTTCTGCCATGATTCTTCCCTACTGTGGCCCCAATGAGATCAACCACTTC
TTCTGTGAAGTTCCTGCTGTGTTGAAATTGGCCTGCACAGACACCTCTCTCAATGACCAG
GTGGACTTCATCCTAGGCTTCATCCTTCTCTTGGTCCCGCTCTCCCTCATCATTGTTGTC
TACATCAATATCTTTGCTGCTATCTTGAGGATCCGCTCAACTCAAGGGCGGATCAAGGCC
TTCTCCACCTGTGTCTCCCACATCACTGTGGTCACCATGTTTTCAATCCCATGTATGGTT
ATGTATATGAGGCCTGGCTCTGAGTCCTCCCCAGAAGAGGACAAGAAGCTGGCTCTGTTC
TACAATGTCATCTCTGCCTTCCTCAACCCCATCATCTACAGCCTTCGTAATAAAGATGTG
AAAAGGGCTTTCCTCAAGGTGGTGGGCAGCAGCAAAGGGTCAGGG


Conceptual translation

MQDFLWRNRSSLTEFVLLGFSSDTRINGTLFGVFLLLYLSTLLGNGLIITLIHMDSRLHT
PMYFFLSILSILDMGYVTTTVPQMLVHLVCEKKTISYVGCVAQMYIFLMLGITESWLFAI
MAYDRYVAICHPLRYKVIMSPLLRGSLVAFCGFWGITCALIYTVSAMILPYCGPNEINHF
FCEVPAVLKLACTDTSLNDQVDFILGFILLLVPLSLIIVVYINIFAAILRIRSTQGRIKA
FSTCVSHITVVTMFSIPCMVMYMRPGSESSPEEDKKLALFYNVISAFLNPIIYSLRNKDV
KRAFLKVVGSSKGSG