Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13p3 Olfactory Receptor

Gene Symbol Or13p3
Organism Mouse
Family 13
Subfamily p
Pseudo No
Location chr4:118709409-118710344 (+)
Aliases Olfr1341, RP23-154A15.6, MOR258-1

Sequence information


Nucleotide sequence

ATGCAAGGTCCCAATCAGACCTTTGTGACAGAATTCATCCTTCTGGGCTTCTCCCTGAGC
CCTAGGACCACACCTCTTCTCTTCTCAGCCTTTCTGATAATTTACTTGTTGATCATTCTG
GGCAATGGCTTGATCTTCATCCTCATCTGCTTGGACTCACACCTCCATACCCCCATGTAT
TTCTTCATTGGTGTTCTTTCCATGTTGGACTTAGGCTACACCACCACAACTGTGCCCCAG
ATGTTGGCACATCTGGCCAGCCAGAAGAAGACAATCTCTTACTCCAATTGTGTGGCTCAA
ATGTACATTTTTTTGGTGCTGGGTGTCACAGAGTCTTGGCTTTTTGCCATCATGTCCATA
GACAGGTATGTGGCCATCTGCCACCCACTCAGGTACAAGGTCATCATGAGCCCATGTCTA
TGTGGGGTAATGGCTATTTTCTGTGGACTCTGTGGTGTCACCGCTGCTCTTGTCTATACC
ATCTTTGCCATGCGCCTCCCCTACTGTGGCCCCAACAAGATCAACCACTTCTTCTGTGAA
GTCCCTGCAGTCTTAAAGCTGGCTTGTGCAGATACATCAGTCAATGACCATGTGGACTTC
ATACTTGGGTTTAGTGTCATACTGATCCCCCTGTCCCTTATCCTGGTCATCTATATCAAC
ATTTTCACTTCCATCTTGAAGATCCGTTCAGCACAGGGGCGACTGAAAGCCTTCTCCACC
TGTGCATCCCACATCACTGTGGTCACCATGTTCTGTGTGCCAGCCATGGTCATGTACATG
AAGCCTGGTTCTAAAGCCTCCCCAGAAGAGGACAAGAAGCTTGCCCTATTCTACAATGTC
ATCTCTGCCTTTCTCAACCCTGTCATCTATAGTCTCCGGAACAAGGATGTGAAGAGGGCT
TTCCTCAAGGTAACAGGCTGTGGTAGACCCCCAGAA


Conceptual translation

MQGPNQTFVTEFILLGFSLSPRTTPLLFSAFLIIYLLIILGNGLIFILICLDSHLHTPMY
FFIGVLSMLDLGYTTTTVPQMLAHLASQKKTISYSNCVAQMYIFLVLGVTESWLFAIMSI
DRYVAICHPLRYKVIMSPCLCGVMAIFCGLCGVTAALVYTIFAMRLPYCGPNKINHFFCE
VPAVLKLACADTSVNDHVDFILGFSVILIPLSLILVIYINIFTSILKIRSAQGRLKAFST
CASHITVVTMFCVPAMVMYMKPGSKASPEEDKKLALFYNVISAFLNPVIYSLRNKDVKRA
FLKVTGCGRPPE