Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or13p3 Olfactory Receptor

Gene Symbol Or13p3
Organism Rat
Family 13
Subfamily p
Pseudo No
Location chr5:137546860-137547795 (+)
Aliases Olr858

Sequence information


Nucleotide sequence

ATGCAAGGTTCCAACCAGACCTTTGTGACAGAATTCATCCTTCTGGGCTTCTCCCTTAGC
CCCAGGACCACACCTCTACTCTTCTCGGCCTTTCTGACACTTTACATGTTGATCCTTCTG
GGCAATGGCTTGATCTTCATCCTCATCTGCTTGGACTCACGCCTCCATACCCCCATGTAT
TTCTTCATTGGCGTTCTTTCCATGTTGGACTTAGGCTACACCACCACAACTGTGCCCCAG
ATGTTGGCACATCTGGCCAGCCAGAAGAAGACAATCTCTTACTCCAATTGTGTGACTCAA
ATGTTCATTTTCTTGGTGCTGGGTGTCACAGAGTCTTGGCTTTTTGCCATCATGTCCATA
GACAGGTATGTAGCAATCTGTCACCCACTCAGGTACAAGGTCATCATGAGCCCATGTCTA
TGTGGGGTAATGGCCATTTTCTGTGGACTCTGTGGTGTCACTGCTGCTCTCGTCTACACT
ATCTTTGCTATGCGCCTCCCCTACTGTGGCCCCAACAAGATCAACCACTTCTTCTGTGAA
GTCCCTGCAGTCTTAAAGCTGGCTTGTGCAGACACCTCAGTCAACGACCATGTAGACTTC
ATCCTTGGGTTTAGTGTCATACTGATCCCCCTGTCCCTTATCCTTGTCATCTATGTGAAC
ATCTTCACTTCCATCCTGAAGATCCGTTCAGCACAGGGGCGACTGAAAGCCTTCTCCACC
TGTGCATCCCACATCACTGTGGTCACCATGTTCTGTGTGCCGGCCATGGTCATGTACATG
AAGCCTGGTTCTAAAGCCTCCCCAGAAGAGGACAAGAAGCTTGCCCTATTCTACAATGTC
ATCTCTGCTTTTCTCAACCCTGTCATCTATAGTCTCCGGAACAAGGATGTGAAGAGGGCT
TTCCTTAAAGTAACAGGCTGGGGTAGATCCCCAGAA


Conceptual translation

MQGSNQTFVTEFILLGFSLSPRTTPLLFSAFLTLYMLILLGNGLIFILICLDSRLHTPMY
FFIGVLSMLDLGYTTTTVPQMLAHLASQKKTISYSNCVTQMFIFLVLGVTESWLFAIMSI
DRYVAICHPLRYKVIMSPCLCGVMAIFCGLCGVTAALVYTIFAMRLPYCGPNKINHFFCE
VPAVLKLACADTSVNDHVDFILGFSVILIPLSLILVIYVNIFTSILKIRSAQGRLKAFST
CASHITVVTMFCVPAMVMYMKPGSKASPEEDKKLALFYNVISAFLNPVIYSLRNKDVKRA
FLKVTGWGRSPE