Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13p4 Olfactory Receptor

Gene Symbol Or13p4
Organism Mouse
Family 13
Subfamily p
Pseudo No
Location chr4:118689506-118690450 (-)
Aliases Olfr1342, RP23-154A15.5, MOR258-3

Sequence information


Nucleotide sequence

ATGCAGACCCTTAGGAAGGACAACTGCAGCTCAGTGTCTGAGTTCCTCCTCCTGGGCTTC
TCCAGCGAATCCCAGGTCAGAGTGGCCCTGTTTATCTTTTTTCTTCTTCTCTACATGATC
ACCCTCCTGGGCAACGGGCTCATCATCACCCTGATTTACCTAGACTCTCGCCTCCACACA
CCCATGTACTTCTTTCTCAGTATCCTCTCTTTGGTAGACATGAGTTACGTCACTACCACT
GTGCCCCAGATGCTGGTTAACATGGTGTGTCCAAGGAGGACCATCTCCTGGGGTGCTTGT
GTAGCCCAGATGTTCATCTTCCTGCTGCTGGGTATTGCTGAGTGTGTTCTCTATGCCATC
ATGGCCTACGACAGGTATGTCGCCATCTGCTTCCCCCTTCACTACTCTGTACTCATGAGC
CGTCTTGTGTGTATCAAGATGGTCACAGTCTGCTGGTCCATCAGCATCACTGGTGCTCTG
ATCTACACTGTCTTCACCATGCGTCTGCCCTACTGTGGTCCCTACAAGATCAACCACTTC
TTCTGTGAGGTCCCCGCTGTCCTGAAGTTGGCCTGTGCAGACACATCCTTCAATGACCGC
TTGGACTTCATCCTGGGTTTCATCTTCCTTTTGGTCCCTCTCTCCCTCATCCTGGCCTCC
TATGCCTGCATCTTTGCCTCCATCTTAAGAATCCGCTCATCCCAGGGGAGGCTCAAGTCC
TTCTCCACGTGTGCATCCCACATCACTGTGGTCACCATGTTCTATGGGCCAGCCATGATC
ATGTACATGAGGCCCGGTTCTTGGTATGACCCAGAACGGGACAAGAAGCTGGCTCTGTTC
TACAATGTTGTCTCTGCCTTCCTCAACCCCATCATCTACAGCCTCCGGAATAAAGATGTA
AAGGGTGCTTTTCTGAAAGTACTAGGAGACAGAGGGGCAGCCAAG


Conceptual translation

MQTLRKDNCSSVSEFLLLGFSSESQVRVALFIFFLLLYMITLLGNGLIITLIYLDSRLHT
PMYFFLSILSLVDMSYVTTTVPQMLVNMVCPRRTISWGACVAQMFIFLLLGIAECVLYAI
MAYDRYVAICFPLHYSVLMSRLVCIKMVTVCWSISITGALIYTVFTMRLPYCGPYKINHF
FCEVPAVLKLACADTSFNDRLDFILGFIFLLVPLSLILASYACIFASILRIRSSQGRLKS
FSTCASHITVVTMFYGPAMIMYMRPGSWYDPERDKKLALFYNVVSAFLNPIIYSLRNKDV
KGAFLKVLGDRGAAK