Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13p5 Olfactory Receptor

Gene Symbol Or13p5
Organism Mouse
Family 13
Subfamily p
Pseudo No
Location chr4:118734531-118735475 (+)
Aliases Olfr1339, RP23-154A15.8, MOR258-2

Sequence information


Nucleotide sequence

ATGCAAGGCTCCTCCTATGAGAATCACAGCTCCGTGTCTGAGTTCATCCTTCTGGGTTTC
TCCAGTAATTTCCAACTTAATATAATCCTCTTCAATGTCTTCTTCTTCCTCTACCTCTCT
ACGCTTGTGGGCAATGGGCTCATTGTCACCTTGATCCACCTGGACTCCCGTCTCCATACA
CCCATGTACTTCTTCCTCAGTGTCCTTTCCATGCTGGATATGAGCTATGTCACCACCACA
GTGCCTCAGATGTTAGTGCATCTCCTCTGCCAGAAGAAAACTATCTCCTATTCTGGGTGT
GTGGCCCAGATGTACATCTTTCTGGTGTTAGGCATCACTGAGGGCTGGTTGTTCTCTGTC
ATGGCCTATGATAGATATGTAGCCATTTGCCACCCACTCAGATATAAGGTTATCATGAGG
CCTTGGCTGTGCGGGGCAATGGTAGTCTTTTGTGGACTATGGGGTGTCAGCTGTTCTCTG
ATCTACACTGTTTTCACTATGAGGCTGCCCTACTGTGGCCCCAATGAGATCAATCACTTC
TTCTGTGAGGTCCCTGCTGTTCTGAAGCTTGCCTGTGCAGACACATCCCTCAATGACCGG
ATAGACTTTATCCTAGGCTTTATCCTTCTCCTGGTACCTCTTTCCTTCATCCTGGCCTCT
TACGTCTGCATCTTTGCCACCATTCTGAGAATCCGCTCAGCCCAAGGTCGACTGAAGGCC
TTTTCCACCTGTGCCTCTCACATCACTGTGGTCACCATGTTCTGTGGACCTGCCATGTTT
ATGTACATGAACCCTGGGGCCAACGCCTCCCCAGAGAGGGACAAGAAACTGGCTCTGTTC
TACAATGTCATCTCTGCTTTCCTCAACCCTATAATCTACAGCCTCAGAAACAAAGATGTG
AAGAGGGCTTTCCTCAAAGTAACAGGCTGGGGAGGAGCCACTGAG


Conceptual translation

MQGSSYENHSSVSEFILLGFSSNFQLNIILFNVFFFLYLSTLVGNGLIVTLIHLDSRLHT
PMYFFLSVLSMLDMSYVTTTVPQMLVHLLCQKKTISYSGCVAQMYIFLVLGITEGWLFSV
MAYDRYVAICHPLRYKVIMRPWLCGAMVVFCGLWGVSCSLIYTVFTMRLPYCGPNEINHF
FCEVPAVLKLACADTSLNDRIDFILGFILLLVPLSFILASYVCIFATILRIRSAQGRLKA
FSTCASHITVVTMFCGPAMFMYMNPGANASPERDKKLALFYNVISAFLNPIIYSLRNKDV
KRAFLKVTGWGGATE