Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13p8 Olfactory Receptor

Gene Symbol Or13p8
Organism Mouse
Family 13
Subfamily p
Pseudo No
Location chr4:118726183-118727193 (+)
Aliases Olfr1340, MGC123648, MGC123701, MOR258-6

Sequence information


Nucleotide sequence

ATGGATTTTGCAAATTCTAGCAAGGAGGACAGTAATATTCCCTCTTTTCTCTTTAGAAGG
AAGGCCATGCACAGTCGAGGCTGGAGAAATCACAGCTCTGTAACTGAGTTCATCCTCTTG
GGCTTCTCCAGAAACCCCAGGACCAATTGGATCCTTTTTTTTCTCTTCCTCTTCCTCTAC
TTATTTACAGTCCTGGGTAATGGACTCATTGTTACCCTGATTAGAATAGATGCTCGTCTC
CACACACCCATGTATTTCTTTCTCAGCATCCTCTCCCTCCTGGATCTGAGTTATGCCACC
ACGACCGTGCCCCAGATGTTGGCTCATCTAGTAAGCAAGACTAAGACTATCTCTTACACT
GGGTGTGTGATTCAGATGTATATTTTCTTGACACTAGGCATCACTGAGACCTGGATTTTT
GCAGCTATGGCCTATGACAGATATGTTGCTATATGTTATCCACTCCACTATGGAGTCAAG
ATGAGCCAAACCCTATGCATAGCCCTGGTGGTCAGCTCTGCCCTTTGTGGCCTCATCTGT
GCCCTTGTCTACACAGTCTTTGCAATGAATCTTCCTTACTGTGGCCCCAATGAGATCAAC
CACTTCTTTTGTGAAATCCCTGCTGTCTTGAAGTTGGCCTGTGCAGACACATCCCTCAAT
GACCAAGTAGACTTCATCCTGGGCTTCATCTTGCTTCTGATCCCATTATCCCTCATTTTG
GCCTCATATGTTCGGATCTTCATAGCCATTCTAAGGATCTGCTCTACCCAAGGACGGATG
AAGGCCTTCTCCACCTGTGCTTCACACATCACTGTGGTCACCATGTTCTGTGTTCCATGC
ATGGTCATGTACATGAGACCTGGCTCTGAAGCCTCCCCAGAAGATGATAAGAAGCTGGCC
TTGTTCTATAATGTCATTTCTGCCTTCCTTAACCCCATTATTTACAGTCTCCGGAACAAG
GATGTGAAGAAGGCTTTCTTCAAGTTAATTGGAAGGGGTGAGGACACCCAG


Conceptual translation

MDFANSSKEDSNIPSFLFRRKAMHSRGWRNHSSVTEFILLGFSRNPRTNWILFFLFLFLY
LFTVLGNGLIVTLIRIDARLHTPMYFFLSILSLLDLSYATTTVPQMLAHLVSKTKTISYT
GCVIQMYIFLTLGITETWIFAAMAYDRYVAICYPLHYGVKMSQTLCIALVVSSALCGLIC
ALVYTVFAMNLPYCGPNEINHFFCEIPAVLKLACADTSLNDQVDFILGFILLLIPLSLIL
ASYVRIFIAILRICSTQGRMKAFSTCASHITVVTMFCVPCMVMYMRPGSEASPEDDKKLA
LFYNVISAFLNPIIYSLRNKDVKKAFFKLIGRGEDTQ