Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or13p9-ps Olfactory Receptor

Gene Symbol Or13p9-ps
Organism Mouse
Family 13
Subfamily p
Pseudo Yes
Location chr4:118672624-118673522 (-)
Aliases Olfr1343-ps1, MOR258-4P

Sequence information


Nucleotide sequence

ATGCAGGAACTCAGCCAGATCACCGTGACAGAATTCATTTTACTGGGCTTCACCCCCGAC
CCCAGGACCAATCCTCTGCTCTTCCCTTTCTTTTTGGTCTTCTACCTGCTGATCCTCCTG
AGCAACAGCCACCTCCTTGCGATCATCCACCAGGACTCAGACCTTCACACGCCACCTACG
TACTTTTTCATTGGTGTTCTCTCCATGGTGGGCGTGTGCTATGCCACCACCACTGTGTCT
CAGACGCTGGCACATATCCTCAGCAGGAAGAGAGCCATCTCTTTTACAAGATGTGTAGCC
CACATGTACATCTTTCTCCTCTTTGGGGTCACTGAATCCTGGCTTCTCTCCATCATGTCT
GTGGACAGGTATATAGCTATCTGCCACCCGCTAAGGTACAAGTCATCGTGAGCCAAGGGA
TGTGTCTCCTAATGGTGGGTATCTGTGCCACCTATGGTGTGGTGGGTGGCCTGTGCTGTA
CCTTCTTTGCTATGCGACTGCCCTATTGTGGTCCTAGTGAAATTGATCACTACTTCTGCG
AGGTCCCTGCAGTTCTGAAGTTGGCCTGTGCAGACACATCCCTCAGTGACTTCGTGGACT
TCATCATAGGCTTCAATGTCATCGTAGTCCCTCTCTCCCTCATTGCCATTGTCTATGCCA
ACATCTTCACTGTCATCATGAAGATTCGCTCAACCCAGAGGAGGACCAAGGACCAAGGTG
AAGACCTGCGCCTCCCACATCACTGTGGTCACCATGTTTGCCATCTCATGCAGCATCATG
CACATGAGTCCTGTCTCTGGCTCCTTATCAAACAGCGGCAAGAAAATGGCCTTTTCTATA
ACATTGCTACAGCCTTCCTTAACCCTGTCATCTACAGTCTAAGGAACAAGGATGTGAAA


Conceptual translation

MQELSQITVTEFILLGFTPDPRTNPLLFPFFLVFYLLILLSNSHLLAIIHQDSDLHTPPT
YFFIGVLSMVGVCYATTTVSQTLAHILSRKRAISFTRCVAHMYIFLLFGVTESWLLSIMS
VDRYIAICHPLRY/VIVSQGMCLLMVGICATYGVVGGLCCTFFAMRLPYCGPSEIDHYF
CEVPAVLKLACADTSLSDFVDFIIGFNVIVVPLSLIAIVYANIFTVIMKIRSTQRRTKDQ
GE\CASHITVVTMFAISCSIMHMSPVSGSLSNSGKKM/LFYNIATAFLNPVIYSLRNK
DVK