Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or13p9 Olfactory Receptor

Gene Symbol Or13p9
Organism Rat
Family 13
Subfamily p
Pseudo No
Location chr5:137514755-137515690 (-)
Aliases Olr856

Sequence information


Nucleotide sequence

ATGCAGAAACTCAACCGGACCGCTGTGACAGAATTCATCTTACTGGGCTTCGCCCCCGAC
CCCAGGACCAATCCTCTGCTCTTCGCTTTCTTCTTGGTCTTTTACCTGCTGATCCTCCTG
AGCAACAGCCTCCTCCTCACGCTCATCTACCAGGACTCGCGACTTCACACACCCATGTAC
TTTTTCATTGGCGTCCTCTCCATGTTGGACGTGTGCTATACCACCACCACCGTGCCCCAG
ATGCTGGTGCACATCCTCAGCAGGAAGAGAGCCATCTCTTTTACAAGATGCGTGGCCCAG
ATGTACATCTTCCTCCTCTTCGGGGTCACTGAGTCCTGGCTTTTCTCCATCATGTCTGTG
GACAGGTATGTTGCTATCTGCCACCCGCTAAGGTACAAGGTCATCATGAGTCGTGGGATG
TGTCTCCTAATGGTGGGTATCTGTGCCGCCTACGGTGTGGTGGGTGGCCTGTGCTACACC
TTCTTTGCTATGCGACTGCCCTATTGTGGTCCTAATGAAATTGATCATTACTTCTGCGAG
GTCCCTGCTGTTCTGAAGTTGGCCTGTGCAGACACATCCCTCAATGACTTGGTGGACTTC
ATCACAGGCTTCAACGTCATTGTGGTCCCTCTCTCCCTCGTTGCCATTGTCTACGCCAAC
ATCTTCAACACCATCATGAAGATCCGCTCAACCCAGGGGAGGATCAAGGCCTTCTCCACC
TGCACCTCCCACATCACTGTGGTCACCATGTTCGCCATCCCATGCATCATCATGTATATG
AGTCCTGGCTCTGGCTCCTTATCAAACAGCGGCAAGAAAATGGCTCTCTTCTATAACATT
GCCACAGCCTTCCTTAACCCTGTCATCTACAGTCTAAGGAACAAGGATGTGAAAAACGCT
TTCCTTAAATTGGTGGGAAGGAGCGGGGCTTCAAAG


Conceptual translation

MQKLNRTAVTEFILLGFAPDPRTNPLLFAFFLVFYLLILLSNSLLLTLIYQDSRLHTPMY
FFIGVLSMLDVCYTTTTVPQMLVHILSRKRAISFTRCVAQMYIFLLFGVTESWLFSIMSV
DRYVAICHPLRYKVIMSRGMCLLMVGICAAYGVVGGLCYTFFAMRLPYCGPNEIDHYFCE
VPAVLKLACADTSLNDLVDFITGFNVIVVPLSLVAIVYANIFNTIMKIRSTQGRIKAFST
CTSHITVVTMFAIPCIIMYMSPGSGSLSNSGKKMALFYNIATAFLNPVIYSLRNKDVKNA
FLKLVGRSGASK