Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or14a256 Olfactory Receptor

Gene Symbol Or14a256
Organism Mouse
Family 14
Subfamily a
Pseudo No
Location chr7:86615639-86616643 (-)
Aliases Olfr294, MOR219-5

Sequence information


Nucleotide sequence

ATGCTCAATGCCACTAGAATAACAGGGTTCATCCTTATGGGATTCTCGGTTGCTCCTGAA
CTACAGACTGTGTGTGGGCTGTTCTTGCTGGTAATGTACCTAGCAGTCATAATGAGTAAC
CTACTTCTCATCACGCTCATCACCCTGGATCTGAAACTCCAAACACCCATGTACTTTTTC
TTGAAGAATTTGTCCCTGTTGGATGTATTCTTTATTTCTGTTCCAATCCCAAATTTCTTT
ATCAATAGCATAACTCACAATAATTCAATTTCTATTCTGGGTTGTGCCCTCCAATTGTTT
TTAATGACTTCTTTTGGAGCTGGAGACGTATTTGTCCTAACAGCCATGTCATATGACCGC
TATGTTGCCATCTGCTGTCCCCTACACTATGAGACCATCATGAGTAGTCGTAACTGTATG
CTGATGGTGGGTGTTTCCTGGGCTACTGGAATTCTGTTTGGAGCTTTATACACAGCTGGC
ACATTTTCCATGCCTTTCTGTGGCTCCATGGTGATCCCACAGTTTTTCTGTGATGTTCCC
TCATTGTTAAGGATCTCCTGCTCTGACACACTTGTGGTCATTTATATAAGTCTTGGAATT
GGTTTTTGTCTGGGCATGGTTTGTATCATATGTGTTGTGCTCTCTTACTTTTACATTTTC
TCCACTGTGCTGAAGATTCCTACCACTAAAGGTCAGTACAAAGCATTTGGCACCTGTATC
CCCCATCTCACTGTTTTCAGTGTTTTCATTGCTACTGCTTGCTTTGTCAATCTGAAGCCA
CCCTCACGTTCAGCATCAATTGCAGACAGTCTGTTTTCTGTGCTATATACTGTGTTGCCT
CCAGCACTTAATCCTGTGATTTACAGCCTGAGAAATACTGATGTCAAGTGTGCTTTGAGG
AGTTTGCAAAAAATTCTCTGCCCAAGGGATTCACTTCACTTAAGAGTTCTAAGTATCTGT
CCATGGTATAGTGCCTCACATTTTACAACCAAGCTTTGTAATTAT


Conceptual translation

MLNATRITGFILMGFSVAPELQTVCGLFLLVMYLAVIMSNLLLITLITLDLKLQTPMYFF
LKNLSLLDVFFISVPIPNFFINSITHNNSISILGCALQLFLMTSFGAGDVFVLTAMSYDR
YVAICCPLHYETIMSSRNCMLMVGVSWATGILFGALYTAGTFSMPFCGSMVIPQFFCDVP
SLLRISCSDTLVVIYISLGIGFCLGMVCIICVVLSYFYIFSTVLKIPTTKGQYKAFGTCI
PHLTVFSVFIATACFVNLKPPSRSASIADSLFSVLYTVLPPALNPVIYSLRNTDVKCALR
SLQKILCPRDSLHLRVLSICPWYSASHFTTKLCNY