Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or14a257 Olfactory Receptor

Gene Symbol Or14a257
Organism Mouse
Family 14
Subfamily a
Pseudo No
Location chr7:86488554-86489564 (-)
Aliases Olfr298, MOR219-4

Sequence information


Nucleotide sequence

ATGGAAGACTCTAGCATGTCCAATGACACTAGAATAACAGGGTTCATCCTTATGGGATTC
TCGGCTGCTCCTGAACTACAGACTGTATGTGGGCTGTTCTTTCTGGTAATGTACGTTGCA
GTCATAATGAGTAACCTCCTCCTCATCACACTCATCACCCTGGATCTGAAACTCCAAACA
CCTATGTACTTTTTCTTGAAGAATTTGTCCCTGTTGGATATCTTCTTTATTTCTGTACCA
ATCCCAAATTTCTTTATCAATAGCATAACTCACAATAACTCAATTTCTATTCTGGGTTGT
GCCCTCCAAGTGTTTTTAATGACTTCTTTTGCATCTGGGGATGTATTTGTTCTAACAGCA
ATGTCATATGACCACTATGTTGCCATCTGCTGTCCCCTACACTATGAGACCATCATGAGT
AGTGGTAACTGTGTGCTGATGGTGGGTGTTTCCTGGGCTATTGGAGTACTCTTTGGAGCT
TTATACACAGCTGGCACATTTTCCATGCCTTTCTGTGGCTCCATTGTGATCCCACAGTTT
TTCTGTGATGTTCCCTCATTGTTAAGGATCTCCTGCTCTGACATACTTGTGGTCATTTAT
ACAAGTCTTGGAATGGGTGTTTGTCTGGGCATGTCTTGTTTCATCTGCGTTGTGATCTCT
TACTTTTACATTTTCTCCACTGTGCTGAAGATTCCTACCACTAAAGGTCAGTCCAAAGCA
TTTGCCACCTGCCTCCCCCATCTCACTGTTTTCAGTGTTTTCATTGTTACAGCTTGCTTT
GTCTATCTGAAGCCACCCTCAGTTGTACCATCAATTTCAGACAGGCTGTTTTCTGTGCTA
CACACTGTGTTGCCTCCAGCACTTAATCCTGTGATTTACAGCCTGAGAAATAGTGATGTC
AAGCGTGCTTTGAAGAGGTTGCAACAAAATCTCTGTCCAAGTGGTTCACTTCATGTAACA
ATTCAAAGTAACTGCCCATGGTTTTGTGGCTCACATATTAAGCAAATTTTG


Conceptual translation

MEDSSMSNDTRITGFILMGFSAAPELQTVCGLFFLVMYVAVIMSNLLLITLITLDLKLQT
PMYFFLKNLSLLDIFFISVPIPNFFINSITHNNSISILGCALQVFLMTSFASGDVFVLTA
MSYDHYVAICCPLHYETIMSSGNCVLMVGVSWAIGVLFGALYTAGTFSMPFCGSIVIPQF
FCDVPSLLRISCSDILVVIYTSLGMGVCLGMSCFICVVISYFYIFSTVLKIPTTKGQSKA
FATCLPHLTVFSVFIVTACFVYLKPPSVVPSISDRLFSVLHTVLPPALNPVIYSLRNSDV
KRALKRLQQNLCPSGSLHVTIQSNCPWFCGSHIKQIL