Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or14a257 Olfactory Receptor

Gene Symbol Or14a257
Organism Rat
Family 14
Subfamily a
Pseudo No
Location chr1:150172378-150173331 (-)
Aliases Olr27

Sequence information


Nucleotide sequence

ATGGAAGATCCTAGCATGTCCAATGTCTCTAGAATTACAGGGTTCATCCTTATGGGATTC
TCGGATGTTCCTGAGCTACAGACTGTATGTGGGCTGTTCTTCCTGGTAATGTACTTAGCA
GTCATAATGAGTAACTTCCTCATCATCACTCTCATCACCGTGGATCTGAAACTCCAAACG
CCTATGTACTTTTTCCTAAAGAATTTGTCCCTGTTGGATGTCCTTTTTATTTCTGTTCCA
ATCCCAAATTTCTTTATCAATAGCATAACTCACAATAATTCAATTTCTATTCTGGGTTGT
GCCCTGCAAGTGATTTTAATGACATCTTTTGCATCTGGGGACTTATTTGTCCTAACAGCA
ATGTCATATGACCGCTATATTGCCATCTGTTCTCCTCTACATTATGAAGCCATCATGAGT
CGCAGTAACTGTGTGCTGATGTTAGGTGTTTCCTGGGCTACTGGGGTACTCTTTGGAACT
TTATACACAGCTGGCACATTTTCCCTGCCCTTCTGTGGCTCCTGTGTGATCTCACAGTTT
TTCTGTGATGTTCCCTCATTGTTAAGGATTTCCTGCTCTGACACACTTGTGGTCATTTAC
ACAAGTCTTGGAATTGGTGTCTGTCTGGGCATATCTTGTTTCATCTGTGTTGTGATCTCT
TACTTTTACATTTTCTCCACTGTGCTGAAGATTCGTACCACTAAGGGTCAGTCCAAAGCA
TTTGCCACCTGCCTTCCCCACCTCACCGTTTTCAGTGTTTTCATTGTTACTGCTTGCTTT
GTCTATCTGAAGCCACCGTCAAATATAGCATCAATTTCAGATAGAGTGTTTTCTGTGCTG
TACATTGTGTTGCCTCCAGCACTTAATCCTGTGATTTATAGCCTGAGAAATACTGATATC
AAGTGTAGTTTGAGGAGTTTGCAACAAAATCTCTGCCCAAGGAGGTACTTCACT


Conceptual translation

MEDPSMSNVSRITGFILMGFSDVPELQTVCGLFFLVMYLAVIMSNFLIITLITVDLKLQT
PMYFFLKNLSLLDVLFISVPIPNFFINSITHNNSISILGCALQVILMTSFASGDLFVLTA
MSYDRYIAICSPLHYEAIMSRSNCVLMLGVSWATGVLFGTLYTAGTFSLPFCGSCVISQF
FCDVPSLLRISCSDTLVVIYTSLGIGVCLGISCFICVVISYFYIFSTVLKIRTTKGQSKA
FATCLPHLTVFSVFIVTACFVYLKPPSNIASISDRVFSVLYIVLPPALNPVIYSLRNTDI
KCSLRSLQQNLCPRRYFT