Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or14a261-ps Olfactory Receptor

Gene Symbol Or14a261-ps
Organism Rat
Family 14
Subfamily a
Pseudo Yes
Location chr1:150280836-150281622 (-)
Aliases Olr33-ps

Sequence information


Nucleotide sequence

ACTTTGTTAGTTTTGCTTTTTTCTCATACCTGACAGGTTATGGAAGAATCTAGCAAGCCC
ATTGTCACTCAAAAAACAGGGTTCATCCTCATGAGATGTTCCTGAGCTACAGACTATATG
TGGGGTGTTCTTCCTTGTAGTGTACAGAACAGTCATAATGAGTAACATCCTCATCATCAC
TCTCATCAGTCTGAATTTGAAACTCCAAACACCCCTGTACTTTTTCCTGAAGAATTTGTT
CCTGTTTGGATGTCTTCTTCATTTCTGTTCCAAACCCTAATTTTATTATCAATAGCATAA
CTCACTATAATTCAATTTCAATTATGGGTTGTGCCCTCCAAGTATTTTTAATGACTTCTT
TTGCATCTGGGGAAGGATTTGTCCTAACAGCAATGTCACATGACTAGTAAATTGCCATTT
GCTCTCCCCTACACTATGAGGCCATCATGAGTAGTGGTAACTGTGTGCTGATGGTGGGTG
TTTCCTGGGCTACTGGAGTAGTCTTTGGAACTTTATACACAACTCGAATGCTTTCCATGC
CTTTCAGAAACTCCAATGTGATCCCAGTTTTTCTGTGATATTCCCTCATTGTTAAGAATT
TCCTGCTCTAACTCACTTTTGGTCATTTATACAAATGTTGAAATTGGTGTCTAATCTTGT
AATTGGTGTTTGTCTGGGCATGTCTTGTTTCATTTTTTTTTATATTTTTTTTATTAACTT
GAGTATTTCTTATATACATTTCGAGTGTTATTCCCTTTCCCGGTATCCGGGCAAACATCC
CCCTCCC


Conceptual translation

PELQTICGVFFLVVYRTVIMSNILIITLISLNLKLQTPLYFFLKNL\CLDVFFISVPNP
NFIINSITHYNSISIMGCALQVFLMTSFASGEGFVLTAMSHD**IAICSPLHYEAIMSSG
NCVLMVGVSWATGVVFGTLYTTRMLSMPFRNSNVI\FFCDIPSLLRISCSNSLLVIYTN
VEI/CLIL*LVFVWACLVSFFFIFF