Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or14c43 Olfactory Receptor

Gene Symbol Or14c43
Organism Rat
Family 14
Subfamily c
Pseudo No
Location chr1:150067242-150068234 (+)
Aliases Olr23

Sequence information


Nucleotide sequence

ATGATGGCCAATTCTACCCTAGTGACTGAGTTCCTCCTGGAGGTTTTTGCCAAGTCTCGG
GAGCTGAGGATCCTACTCAGTGTGCTGTTCCTCCTGGTGTATCTGGGCAGTCTGTTAGGG
AACCTTATCATCATCATTGCTACTACAGTTGACCAAACCCTGAACACACCCATGTATTAC
TTCCTTAGGAATCTTTCAATTGTAGATATGTGTTATGTTTCTGTCACTGTTCCTAATGCT
TGTTTCAACTCTCTCACAGACCACAGGAACATTTCTGTGGCTGGGTGTGCAGCACAAATC
TTTTTGGTCTTTTTTTGTGCATGTGTAGAGTTGTTTTTACTAACCATCATGGCCCAGGAC
CGTTATGTGGCCATCTGCAAGCCTCTTCTCTACCCTGTGATCATGAACCACCAATTCTGT
GTTCAGATGACACTGGTTTCCCTACATAGCTCTCTTGTCATTGCAAGTGTTCACACTTTC
AAAACATTCCAGCTTTCCTTCTGTCACTCTAATGTAGTCCCTCAGTTCTTCTGTGATGTC
CCCTCTTTGTTGAAGCTTTCATGTTCAGATACCTTTAACAACAAACTCTTAATGCTTCTC
TCTGCTATTGTCATTGGCTGTAGCTGCTTTACGTTCATTGCTGTATCATATGTTCGGATA
TTATCAACTGTGTTGAAGGTTCCTGTCAAAGGAGAGCGAGGGAAAGCCTTTTCCACCTGT
GTCCCTCACATTGTTGTGGTGTCTGTGTTTCTTATTTCTGCTACTTATGTGTATCTAAGA
CCTCCAGTACTAACATTAGAAGTAGTTAAGGAGATGTCTCTTTCGGTGTCTTATACTATT
GTTCCACCATTCTTAAATCCTATAATCTATAGTCTAAGAAATAGACAGATAAAGGCAGCT
GTGAAGAAAGTAATATTAAGACTTTCTTTCACGTTTGAGTATAAAAGAAATGAGTATTTG
TCAGATATTTCTAGAAGAAGGAAACTGACAAAA


Conceptual translation

MMANSTLVTEFLLEVFAKSRELRILLSVLFLLVYLGSLLGNLIIIIATTVDQTLNTPMYY
FLRNLSIVDMCYVSVTVPNACFNSLTDHRNISVAGCAAQIFLVFFCACVELFLLTIMAQD
RYVAICKPLLYPVIMNHQFCVQMTLVSLHSSLVIASVHTFKTFQLSFCHSNVVPQFFCDV
PSLLKLSCSDTFNNKLLMLLSAIVIGCSCFTFIAVSYVRILSTVLKVPVKGERGKAFSTC
VPHIVVVSVFLISATYVYLRPPVLTLEVVKEMSLSVSYTIVPPFLNPIIYSLRNRQIKAA
VKKVILRLSFTFEYKRNEYLSDISRRRKLTK