Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or14c45 Olfactory Receptor

Gene Symbol Or14c45
Organism Mouse
Family 14
Subfamily c
Pseudo No
Location chr7:86526759-86527688 (+)
Aliases Olfr297, MOR220-3

Sequence information


Nucleotide sequence

ATGATGAATTCTACCATGGTGACTGAGTTCCTCCTGGAGGTTTTTGCTGAGACTTGGGAG
CTCAGGGTCCTACTCAGTGTGCTGTTCCTGCTGGTGTACCTGGGCAGCCTGTTCGGGAAT
CTTACCATCATCATTGTTACTACAGTTGACCAGACCCTGAACACACCCATGTACTTCTTC
CTCAGGAATCTGTCCATCTTAGACATGTGCTATGTTTCTATTACTGTGCCCAATGCCTGT
ATAAACTCTCTCACTGACCACAGGAACATTTCTGTGACTGGGTGTGCAGCACAGATCTTT
TTGTTCTTCTTTTGTGCATGTGTAGAGGTTCAGTTTCTCACCATCATGGCTCAGGACCGC
TATGTGGCCATATGCAAGCCTCTCCTCTACCCTATGATTATGAACCATCAATTCTGTGTT
CAGATGACACTGGCTTCCCTACTTACCTCACTTATCCTTTCAGGTATGAACACTTTCAAA
ACTTTCCAGCTGTCCTTTTGTCACTCAAATGTAGTTCCTCAGTTCTTCTGTGAGCTGCCT
GCTTTGCTGAGGCTTACTTGCTCTGACACCTTTAACAACAAAATCATACTTCTTCTGACT
GCCATTGGCCTTAGTGGTACCTGCTTTACTTTCATTGCCATATCATATGTTCACATATTA
TCAACTGTCTTGAAAGTTCCTGTCAAAGGAGAGAGAGGGAAAGCCTTTTCTACCTGTGTC
CCTCACATCATTGTAGCATATTTGTTTCTTTGTTCTGGTGCCTATGCATATCTAAGACCT
CCAGCAATCTCAGAAGTAGTTGAGGATATGACTCTTTCTGTATTTTATACCACTGTTCCT
CCATTCTTAAACCCTATTATCTATAGCCTTAGAAACAAACAAATAAAGAAGGCTGTGAAG
AAAGTAATATTCAGATTTTTCATAGTTGAA


Conceptual translation

MMNSTMVTEFLLEVFAETWELRVLLSVLFLLVYLGSLFGNLTIIIVTTVDQTLNTPMYFF
LRNLSILDMCYVSITVPNACINSLTDHRNISVTGCAAQIFLFFFCACVEVQFLTIMAQDR
YVAICKPLLYPMIMNHQFCVQMTLASLLTSLILSGMNTFKTFQLSFCHSNVVPQFFCELP
ALLRLTCSDTFNNKIILLLTAIGLSGTCFTFIAISYVHILSTVLKVPVKGERGKAFSTCV
PHIIVAYLFLCSGAYAYLRPPAISEVVEDMTLSVFYTTVPPFLNPIIYSLRNKQIKKAVK
KVIFRFFIVE