Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or14j10-ps Olfactory Receptor

Gene Symbol Or14j10-ps
Organism Rat
Family 14
Subfamily j
Pseudo Yes
Location chr20:1,033,500-1,034,630 (+)
Aliases Olr1706-ps

Sequence information


Conceptual translation

MIVKNITTMTGFVLKGFSDNHEMQVLQALLFLVTYLLGSAGNFIIITITTLDPQLQSPMY
YFLKHLSILDLSSLSVTIPQYVDSSLARSGYISYGECMMQVF/FTALASSEMAMLTVMS
YDCYVAICLPLHYEVIMGPRKCTWAVAAVWLSGSMSGTLYTVSIHSIRFCGDKIIHQFFC
DVSQLLKLSCSNDHFVIIGMIDFLSVITFACFIGIIISYVHIYSTVLRMPSAESRSKVFS
TCLPHLFVVSLFLSTGFCAYLNPTSGSPSTLEFLFSVFYAVIPPTLNPLIYSLRNETIKS
VVRKLLFNIKFDV