Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or14j10e-ps Olfactory Receptor

Gene Symbol Or14j10e-ps
Organism Rat
Family 14
Subfamily j
Pseudo Yes
Location chr20:1224540-1225475 (-)
Aliases Olr1712-ps

Sequence information


Nucleotide sequence

ATGATTGTGAAAAACATAACCACAACAAGAGGATTTCTCCTTATGGGGTTCTCGGACAAC
CATGAGCTACAGATCTTGCATGCTTTGCTCTTATTGGTGACATACCTATTGGGCTCAACA
GGTAACTTCATCATTATCACCATCACAACACTGGACCCTCAGCTCCAGTCTCCAATGTAT
TACTTTCTGAAGCACCTTTCCATTCTGGACCTCTCATCACTCTCTGTCACAGTTCCTCAG
TATGTTGACAGTTCCCTGGCACGAAGTGGCTACATTTCATATGGCCAGTGCATGATGCAG
GTTTTTTTCTTCACAGCTTTGGCCTATACTGAGATGGCCATTCTCACAGTGATGTCTTAT
GACCGCTATGTGGCCATCTGCCTCCCACTGCACTATGAGGTCATCATGAGTCCCAGAAAA
TGTACTTGGGCTGTGGCAGCTGTGTGGCTAAGTGGAAGCATGTCAGGGACATTATACACA
GCAAGTACACTCTCCATCAGATTCTGTGGGGACAAAGTAATTCACCAGTTCTTCTGTGAT
GTCCTCCAGTTGCTCAAGCTCTCCTGCTCTAATGATCACCTTGTAGTAATTGGAGTGATT
GATTTCCTGTCTGTAATTGCCTTTACCTGCTTTGTTGGGATCGTCTTCTCCTATGTCCAC
ATATTCTCCACAGTTCTCAGGATGCCCTCTGCTGAAAGCAGGTCCAAGGTCTTCTCTACT
TGACTGCCCCACCTTTTTGTTGTCTCATTGTTTCTTTCTTCAGGCGCCTGTGCATATCTA
AACCCAACCTCAGACTCTCCATCTACTTTAGAGTTCTTATTCTCCATCTTTTACACAGTA
ATACCTCCAACTCTCAACCCTCTTATTTACAGTCTGAGAAATGAGACCATAAAGAGTGTT
TTAAGGAAGTTACTGTTTAGTACAAAATTTGCTGGT


Conceptual translation

MIVKNITTTRGFLLMGFSDNHELQILHALLLLVTYLLGSTGNFIIITITTLDPQLQSPMY
YFLKHLSILDLSSLSVTVPQYVDSSLARSGYISYGQCMMQVFFFTALAYTEMAILTVMSY
DRYVAICLPLHYEVIMSPRKCTWAVAAVWLSGSMSGTLYTASTLSIRFCGDKVIHQFFCD
VLQLLKLSCSNDHLVVIGVIDFLSVIAFTCFVGIVFSYVHIFSTVLRMPSAESRSKVFST
*LPHLFVVSLFLSSGACAYLNPTSDSPSTLEFLFSIFYTVIPPTLNPLIYSLRNETIKSV
LRKLLFSTKFAG