Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or14j3b Olfactory Receptor

Gene Symbol Or14j3b
Organism Rat
Family 14
Subfamily j
Pseudo No
Location chr20:1012042-1012989 (+)
Aliases Olr1704

Sequence information


Nucleotide sequence

ATGTTACCAAAAATGATTTGGAAAAATATAACCACAATGAGTGGATTTCTCCTCATGGGG
TTCTCTGACAACCATGAGCTGCAGATCTTACAGGCTTTGCTCTTCTTGGTGACATACCTA
TTGGGCTCAGCAGGTAACTTCATCATTATCACCATCACAACACTGGACCCTCAGCTCCAG
TCTCCAATGTATTACTTTCTGAAGCACCTTTCCATTCTGGACCTCTCATCACTCTCTGTC
ACAGTTCCTCAGTATGTTGACAGTTCCCTGGCACATAGTGGCTACATTTCATATGGACAG
TGCATGCTGCAGGTTTTTTTCTTCACAGCTTTGGCCTGGAGTGAGATGGCCATTCTCACA
GTGATGTCCTATGACCGCTACGTGGCCATCTGCCTCCCACTGCACTATGAGGTCATCATG
GGTCCCAGAAAGTGCACTTGGGCTGTGGCAGCTGTGTGGTTAAGTGGAAGCATCTCAGGA
ACATTATACACAGTAAGTATACTCTCCATCAGATTCTGTGGGGACAAAATAATTCACCAG
TTCTTCTGTGATATCCCCCAGTTGCTGAAGCTCTCCTGCTCTAATGATCACCTTGTAATA
ATGGGAGTGGCTGATTTCCTGTCGGCAATGGCCTTTGCCTGCTTTATTGGGATTGTCATC
TCCTATGTCCACATATTCTCCACAGTTCTCAGGATGCCCTCTGCTGACAGCAGGTCTAAG
GTCTTCTCTACTTGCCTGCCCCACCTTTTTGTTGTCTCATTGTTTCTTTCTACAGGCTTC
TGTGCATATCTAAACCCAACCTCAGACTCTCCAACTGCTTTAGAGTTCTTATTCTCCATC
TTTTACACAGTACTACCTCCAACTCTCAACCCTCTTATTTACAGTCTGAGAAATGAGACC
ATAAAGAGTGTTGTAAGGAAGTTACTCTTTAGTAGAAAATTTGCTTTG


Conceptual translation

MLPKMIWKNITTMSGFLLMGFSDNHELQILQALLFLVTYLLGSAGNFIIITITTLDPQLQ
SPMYYFLKHLSILDLSSLSVTVPQYVDSSLAHSGYISYGQCMLQVFFFTALAWSEMAILT
VMSYDRYVAICLPLHYEVIMGPRKCTWAVAAVWLSGSISGTLYTVSILSIRFCGDKIIHQ
FFCDIPQLLKLSCSNDHLVIMGVADFLSAMAFACFIGIVISYVHIFSTVLRMPSADSRSK
VFSTCLPHLFVVSLFLSTGFCAYLNPTSDSPTALEFLFSIFYTVLPPTLNPLIYSLRNET
IKSVVRKLLFSRKFAL