Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or14j3d Olfactory Receptor

Gene Symbol Or14j3d
Organism Rat
Family 14
Subfamily j
Pseudo No
Location chr20:1172891-1173802 (+)
Aliases Olr1708

Sequence information


Nucleotide sequence

ATGACTGGATTTGTCCTCATGGGATTCTCTGACAACCATGAGCTGCAGGTCTTACAGGCT
TTGCTCTTCTTGGTGACATACCTATTGGGCTCAGCAGGTAACTTCATCATTATCACCATC
ACAACACTGGACCCACAGCTCCAGTCTCCAATGTATTACTTTCTGAAGCACCTTTCCATT
CTGGACCTCTCATCCCTCTCTGTCACAGTTCCTCAGTATGTTGAGAGTTCCCTGGCACGA
AGTGGCTACATTTCCTATGGAGAATGCATGATGCAGGTTTTTTTTTTCACAGCTTTGGCC
TCAAGTGAGATGGCCATGCTCACAGTGATGTCTTATGACCGCTATGTTGCCATCTGCCTC
CCACTGCACTATGAGGTCATCATGGGTCCCAGAAAGTGCACTTGGGCTGTGGCAGCTGTG
TGGCTAAGTGGAAGCATGTCAGGGACATTATACACAGTGAGTATACACTCTATCAGATTC
TGTGGGGACAAAATAATTCACCAGTTCTTCTGTGATGTCCCCCAGTTGCTTAAGCTCTCC
TGCTCTAATGATCACTTTGTAATAATTGGAATGATTGATTTCCTGTCTGTAATTACCTTT
GCCTGCTTTATTGGGATCATCATCTCCTATGTCCACATATTCTCCACAGTTCTCAGGATG
CCCTCTGCTGAAAGCAGGTCTAAGGTCTTCTCTACTTGCCTGCCCCACCTTTTTGTTGTC
TCATTGTTTCTTTCTACAAGCTTCTGTGCATATCTAAACCCAACCTCAGGCTCTCCATCT
ACTTTAGAGTTCTTATTCTCTGTCTTTTATGCAGTAATACCTCCTACTCTTAACCCTCTT
ATTTACAGTCTGAGAAATGAGACCATAAAGAGTGTTGTAAGGAAGTTATTGTTTAATATA
AAATTTGATGTG


Conceptual translation

MTGFVLMGFSDNHELQVLQALLFLVTYLLGSAGNFIIITITTLDPQLQSPMYYFLKHLSI
LDLSSLSVTVPQYVESSLARSGYISYGECMMQVFFFTALASSEMAMLTVMSYDRYVAICL
PLHYEVIMGPRKCTWAVAAVWLSGSMSGTLYTVSIHSIRFCGDKIIHQFFCDVPQLLKLS
CSNDHFVIIGMIDFLSVITFACFIGIIISYVHIFSTVLRMPSAESRSKVFSTCLPHLFVV
SLFLSTSFCAYLNPTSGSPSTLEFLFSVFYAVIPPTLNPLIYSLRNETIKSVVRKLLFNI
KFDV