Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or14j3e Olfactory Receptor

Gene Symbol Or14j3e
Organism Rat
Family 14
Subfamily j
Pseudo No
Location chr20:1185036-1186046 (+)
Aliases Olr1709

Sequence information


Nucleotide sequence

ATGCTTCAGGGTGTTTCTACTGCATTTAATACATTATTTTGTTTTCCAGCTCCTACTACT
AATTCTGTTACCAAAATGATTGTGAAAAATATAACCACAATGAGCGGATTTCTTTTCATG
AGGTTCTCTGACAACCACGAGCTGCAAATCTTAGAGGCTTTGCTCTTCTTGGTGACATAC
CTATTGGGCTCAGCAGGTAACTTCATCATTATCACCATCACAACACTGGACCCACAGCTG
CAGTCTCCAATGTATTACTTTCTGAAGCACCTTTCCATTCTGGACCTCTCATCCCTCTCT
GTCACAGTTCCCCTATATATAGATAATTCACTGGTAGGAAGTGGCTACATTTCATATGGA
CAGTGCATGCTGCAGATTTTTTTCTTCACTGGTTTTGCCTGGGGTGAAGTGGCCATTCTC
ACAGTGATGTCATATGATCGTTATGTAGCTGTTTGCCTTCCACTGCACTATGAGGTCATC
ATGTGTCCCAGAAAGTGTAGGTGGGCTGTGACAGCTGTGTGGCTAAGCAGTGGCATTCCC
GGAACCCTGTACGTAGCAACCATATTCTCTATCAAATTTTGTAGGGCCAAAATAATTCAC
CAATTCTTCTGTGATGTCCCTCAGTTGCTCAAGCTCTCCTGCTCTAATGATCACCTTGTA
GTAATGGGAGTGGCTGATTTCCTCTCCACAATGGCCTTTGCCTGCTTTATTGGGATCATC
ATCTCCTATGTCCACATATTCTCCACAGTTCTCAGGATGCCCTCTGCTGAAAGCAGATCT
AAGGTCTTCTCTACTTGCCTGCCCCACCTTTTTGTTGTCTCATTGTTTCTTTCCACAGGC
TCCTTTGCATACCTAAACCCAACCTCAGACTCTCCAACTGCTTTAGAGTTCCTATTCTCT
GTCTTTTATGCAGTAATACCTCCAACTCTCAACCCTCTTATTTACAGTCTGAGAAATGAG
ACCATAAAGTCTGTTGTAAGAAAGTTACTGTTTAGTATGAAATTTGCTGGT


Conceptual translation

MLQGVSTAFNTLFCFPAPTTNSVTKMIVKNITTMSGFLFMRFSDNHELQILEALLFLVTY
LLGSAGNFIIITITTLDPQLQSPMYYFLKHLSILDLSSLSVTVPLYIDNSLVGSGYISYG
QCMLQIFFFTGFAWGEVAILTVMSYDRYVAVCLPLHYEVIMCPRKCRWAVTAVWLSSGIP
GTLYVATIFSIKFCRAKIIHQFFCDVPQLLKLSCSNDHLVVMGVADFLSTMAFACFIGII
ISYVHIFSTVLRMPSAESRSKVFSTCLPHLFVVSLFLSTGSFAYLNPTSDSPTALEFLFS
VFYAVIPPTLNPLIYSLRNETIKSVVRKLLFSMKFAG