Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or14j7 Olfactory Receptor

Gene Symbol Or14j7
Organism Rat
Family 14
Subfamily j
Pseudo No
Location chr20:820,367-821,332 (-)
Aliases Olr1692

Sequence information


Nucleotide sequence

ATGACTGCAAGAAACATAACAATGAGTGGATTTCTCCTCATGGGGTTCTCTGACAACCAT
GACCTGCAGATCTTACAAGCTTTGCTCTTCTTGGTGACATACCTATTGGGCTCAGCAGGT
AACTTCATCATTATCACCATCACAACACTGGACCCACAGCTACAGTCTCCAATGTATTAC
TTTCTGAAGCACCTTTCCATTCTGGACCTCTCATCCCTCTCTGTCACAGTTCCTCAGTAT
GTTGACAGTTCCCTGGCACGTAGTGGCTACATTTCATATGGCCAGTGCATGATGCAGGTT
TTTTTCTTCACAGCTTTGGCCTGGACTGAGATGACCATTCTCACAGTGATGTCTTATGAC
CGCTATGTGGCCATCTGCCTCCCACTGCACTATGAGGTCATCATGAGTCCCAGAAAGTGC
ACTTGGGCTGTGGCAGCTGTGTGGCTCAGTGGAAGCATCACAGGAACATTATACACAGCA
AGTATACTCTCTATCAGATTCTGTGGGGACAAAATAATTCACCAGTTCTTCTGTGATATC
CCCCAGTTGCTGAAGATCTCTTGCTCTAATGATTACATTGGAGTAGTGAAAATGACTGCT
TTCATGTCTGTATTAGACTTTGCCTGCTTCATGGGGATTGCCTTCTCCTATTGCCAGATA
TTCTCTACAGTTCTCAGGATTCCCTCTGCAGAAGGTCGATCTAAGGTCTTCTCTACCTGC
CTGCCCCATCTCTTTGTTGTTTCATTTTTTCTTTCAACAGGCATTTGTGCCTATCTAAAG
CCAACCTCAGATGCACCAACTGCTTTAGACCACATACTCTCTATTTTTTACACTGTACTC
CCTCCAACTTTAAACCCTGTTATCTATGGTCTAAGAAATGAGTCCTTGAAGGGAGCTGTA
AAGAAGTTACTGTTAAGCGCCGAATTCGTTGGGAAAAATTATTTTTGTTCTTTTGTTCAT
GACTGC


Conceptual translation

MTARNITMSGFLLMGFSDNHDLQILQALLFLVTYLLGSAGNFIIITITTLDPQLQSPMYY
FLKHLSILDLSSLSVTVPQYVDSSLARSGYISYGQCMMQVFFFTALAWTEMTILTVMSYD
RYVAICLPLHYEVIMSPRKCTWAVAAVWLSGSITGTLYTASILSIRFCGDKIIHQFFCDI
PQLLKISCSNDYIGVVKMTAFMSVLDFACFMGIAFSYCQIFSTVLRIPSAEGRSKVFSTC
LPHLFVVSFFLSTGICAYLKPTSDAPTALDHILSIFYTVLPPTLNPVIYGLRNESLKGAV
KKLLLSAEFVGKNYFCSFVHDC