Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1ad1b-ps Olfactory Receptor

Gene Symbol Or1ad1b-ps
Organism Rat
Family 1
Subfamily ad
Pseudo Yes
Location chr10:36456679-36457005 (+)
Aliases Olr1403-ps

Sequence information


Nucleotide sequence

CTCTTCCTGGGACTCTCTGGAAAGTCAGAGAAAGAAGAGGTCATTTTCAGGCTGTTCTTG
TGGATATACTTGGTCAGTGTCTGTGGGAACCTTCTCATCATCCTGGCCATCAGCTGTGAC
CCTCGACTCCACACACCCATGTATTTCTTCTTGGCCAACCTCTCCAGTGTTGACATCTGC
TTTTCCTCAGTCACCGTCCCCAAGGCTCTGGTGAACCACGTGTTGGGAAGCAAGACCATC
TCTTACACAGAGTGTATGGCCCAGATCTATTTCTTGATCACATTCATCAACATGGATGGC
TTCCTCCTGAGTGTGGTGGCCCTAGTG


Conceptual translation

LFLGLSGKSEKEEVIFRLFLWIYLVSVCGNLLIILAISCDPRLHTPMYFFLANLSSVDIC
FSSVTVPKALVNHVLGSKTISYTECMAQIYFLITFINMDGFLLSVVALV\YHCYVAICH
ILHYTMMMRPRLCVLLVAITWFITNPQALFMVRLTFCSHSAVHHFFCDPYLLW