Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1ad8 Olfactory Receptor

Gene Symbol Or1ad8
Organism Rat
Family 1
Subfamily ad
Pseudo No
Location chr10:36499337-36500281 (+)
Aliases Olr1407

Sequence information


Nucleotide sequence

ATGACAAAACTGTCCTCCACAGACATGGATGGGGACAATCAAACAACAGTCACAGAATTC
ATCCTCCTGGGACTCACTGAACAGTCCGAGAAAGAAGAGATTGTGTTTGGAATGTTCTTG
TGGATGTACTTGGTCACCATTTCTGGGAACCTTCTCATCATCCTGGCGATCAGCTGTGAC
CCTCATCTCCACACACCCATGTACTTCTTCTTGGCTAACCTCTCCAGTGTTGACATTAGT
GCTCCATCTGTCATTGTCCCCAAGGCACTGGTGAATCATATGTTGGGAAGCAAGTCCATC
TCTTACATGGGGTGTATGATCCAGATCTATTTCTTCATCACATTCAGCAACATGGATGGC
TTCCTCCTGAGTGTGATGGCCTACGACCGCTATGTGGCCATCTGTCACCCTCTCCACTAC
ACCATGATGATGAGGCCCAGACTCTGTGTCCTCCTGGTGGCCGTATCATGGGTCATCACA
AACCTGCATGCTCTCTTGCACACTCTCCTCATGGTTCGACTCACCTTCTGTTCCCACAAT
GCAGTGCACCACTTCTTCTGTGACCCCTACCCTATCATGAAGCTCTCTTGTTCTGACACC
TTCATCAATGACCTGATGGTCTTCACCATTGGTGGACTGGTATTTCTGACTCCATTTACA
TGCATTATTGTTTCCTATGCCTACATCTTCTCTAAGGTTCTGAAGTTAAAATCTGCCCAT
GGAATAAGGAAATCCCTGTCTACATGTGGGTCTCACCTCACTGTGGTCTCCCTCTTCTAT
GGGGCGATCCTGGGCATCTATATGCATCCTTCATCTACATACACAGTACAGGACACAGTG
GCCACCGTCATCTTCACAGTGGTAACACCGATGGTCAATCCCTTCATCTATAGCTTGAGG
AATCGTGACATTAAAGGGGCTCTGAGGAAGATAATTCTCCGACCT


Conceptual translation

MTKLSSTDMDGDNQTTVTEFILLGLTEQSEKEEIVFGMFLWMYLVTISGNLLIILAISCD
PHLHTPMYFFLANLSSVDISAPSVIVPKALVNHMLGSKSISYMGCMIQIYFFITFSNMDG
FLLSVMAYDRYVAICHPLHYTMMMRPRLCVLLVAVSWVITNLHALLHTLLMVRLTFCSHN
AVHHFFCDPYPIMKLSCSDTFINDLMVFTIGGLVFLTPFTCIIVSYAYIFSKVLKLKSAH
GIRKSLSTCGSHLTVVSLFYGAILGIYMHPSSTYTVQDTVATVIFTVVTPMVNPFIYSLR
NRDIKGALRKIILRP