Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1ak2 Olfactory Receptor

Gene Symbol Or1ak2
Organism Mouse
Family 1
Subfamily ak
Pseudo No
Location chr2:36937121-36938065 (+)
Aliases Olfr356, MOR134-1

Sequence information


Nucleotide sequence

ATGATGACAAGAAACCACAGTAGTGTTTCTGAATTTCTCCTCCTGGGCCTCTCGGAGCAC
TGGGAACAGGAACCTTTACTCTTTGGCATCTTTTTGGTCATATACCTTGTCACTGTGGTG
GGAAATACACTAATCATCCTGGCAATTGTCTCTGATCCACACCTCCACAGTCCCATGTAT
TTCTTCCTGGCTAACCTCTCTCTCACTGACATGTGTTTATCATCTACCACAGTTCCTAGG
ATGCTGGTAAACATCCAAACTCAGAGGCATAGCATCCCCTATGCTGGATGCCTGTCTCAA
ATCTATTTCTTCCTGTGGTTCATTGGACTAGATGTTTTCCTCCTGGCAGTGATGGCTTAT
GACAGACTTGTGGCCATATGCTATCCCCTTCACTACACCTTGGTCATGAGTCCCAGATGC
TGCATCCTGCTGGTGACGACATCCCTATTCCTTGCCCATTCATATGCTCTAACCCACATC
ATTCTGCTGTCTCAGTTATCCTTCTGCATGGACAACATCATTCTCCATTTCTTTTGTGAA
CTGCTTCCCATGTTGAAGCTCTCTTGTTCTAACACTTATGCCAACCAGTGTGTGCTGCTC
TACTGGGGAGGAGCATTAACTGTCTTGATCCCTTTGTTAATCATTGTTTCATATGTCCGC
ATTGTGGCCACCATTGTGAGAGTCCCATCAGCAAGTGGAAAGTGGAAGACCTTCTCCACC
TGTGGGTCCCATCTCTCAGCAGTCTGCCTGTTCTATGTGTCTGCTATTGGGGTGTATTTC
ATTCCATACGCTGCTGATTCAGCTAGCAGGGATAGGATTGCATCAGTGATGTATGCTGTG
GTGACCCCCATGCTGAACCCATTCATCTATAGCCTGAGAAACAAAGATATGACAAGTGCC
TTGAGAAGGTTCCTGAACAAAATTTTGCTGCAACCTCCACAAAGC


Conceptual translation

MMTRNHSSVSEFLLLGLSEHWEQEPLLFGIFLVIYLVTVVGNTLIILAIVSDPHLHSPMY
FFLANLSLTDMCLSSTTVPRMLVNIQTQRHSIPYAGCLSQIYFFLWFIGLDVFLLAVMAY
DRLVAICYPLHYTLVMSPRCCILLVTTSLFLAHSYALTHIILLSQLSFCMDNIILHFFCE
LLPMLKLSCSNTYANQCVLLYWGGALTVLIPLLIIVSYVRIVATIVRVPSASGKWKTFST
CGSHLSAVCLFYVSAIGVYFIPYAADSASRDRIASVMYAVVTPMLNPFIYSLRNKDMTSA
LRRFLNKILLQPPQS