Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1e18 Olfactory Receptor

Gene Symbol Or1e18
Organism Rat
Family 1
Subfamily e
Pseudo No
Location chr10:59956933-59957874 (-)
Aliases Olr1468

Sequence information


Nucleotide sequence

ATGACAGAAGAGAACCAAACTGTGATCTCCCAGTTCCTTCTCCTGGGCCTGCCCATCCCC
TCAGAGCACCAGCACGTGTTCTACGCCCTGTTCCTGTCCATGTACCTCACCACTGTCCTG
GGGAACCTCATCATCATCATCCTCATTCACCTGGACTCCCATCTCCACACACCCATGTAC
TTGTTTCTCAGCAACTTGTCCTTCTCTGATCTCTGCTTTTCCTCTGTTACGATGCCCAAG
TTGTTGCAGAACATGCAGAGCCAAGTTCCATCCATCCCCTTTGCAGGCTGCCTGACACAA
TTATACTTTTACCTGTATTTTGCAGACCTTGAGAGCTTCCTGCTTGTGGCCATGGCCTAT
GACCGCTATGTGGCCATCTGCTTCCCCCTTCATTACATGAGCATCATGAGCCCCAAGCTC
TGTGTGAGTCTGGTGGTGCTGTCCTGGGTGCTGACCACCTTCCATGCCATGCTGCACACC
CTGCTCATGGCCAGATTGTCATTCTGTGCGGACAATATGATCCCCCACTTTTTCTGTGAT
ATATCTCCTTTATTGAAACTGTCCTGCTCTGACACGCATGTTAATGAGTTGGTGATATTT
GTCATGGGAGGGCTTGTTATTGTCATTCCATTTGTGCTCATCATTGTATCTTATGCACGA
GTTGTCGCCTCCATTCTTAAAGTCCCTTCTGTCCGAGGCATCCACAAGATCTTCTCCACC
TGCGGCTCCCATCTGTCTGTGGTGTCACTGTTCTATGGGACAATCATTGGTCTCTACTTA
TGTCCGTCAGCTAATAACTCTACTGTGAAGGAGACTGTCATGGCCATGATGTACACAGTG
GTGACCCCCATGCTGAACCCCTTCATCTACAGCCTGAGGAACAGAGACATGAAAGAGGCA
CTGATAAGAGTCCTTTGTAAAAAGAAAATTACCTTCTGTCTA


Conceptual translation

MTEENQTVISQFLLLGLPIPSEHQHVFYALFLSMYLTTVLGNLIIIILIHLDSHLHTPMY
LFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPFAGCLTQLYFYLYFADLESFLLVAMAY
DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAMLHTLLMARLSFCADNMIPHFFCD
ISPLLKLSCSDTHVNELVIFVMGGLVIVIPFVLIIVSYARVVASILKVPSVRGIHKIFST
CGSHLSVVSLFYGTIIGLYLCPSANNSTVKETVMAMMYTVVTPMLNPFIYSLRNRDMKEA
LIRVLCKKKITFCL