Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1e19b-ps Olfactory Receptor

Gene Symbol Or1e19b-ps
Organism Rat
Family 1
Subfamily e
Pseudo Yes
Location chr10:60172855-60173187 (+)
Aliases Olr1476-ps

Sequence information


Nucleotide sequence

CCCATGTTCTTGTTTCTCTGCAATTTATCTTTTGCCAACCTCTGTTTTTCCTCTGTCACG
ATGCCCAAGTTGTTGCAGAACATGCAGAGCCAAGTTCCATCCATCCCCTATGCAGGCTGC
CTGGCACAGATATACTTCTTTCTGTACTTTGGAGACCTTGGAAACTTCCTGCTTGTGGCC
ATGGCCTATGATCGATATGTGGCCATCTGCTTCCCCCTTCATTACATGAGCATCATGAGC
CCCAAGCTCTGTGTGAGTCTGGTGGTGCTGTCCTGGGTGCTGACCACCTTCCATGCCATG
CTGCACACCTTGCTCAACATAAAAGGGGTGAGA


Conceptual translation

MTRRNQTVISQFLLLGLPIPPEYQHLFHALFLSMYLTTVLGNLTIIILILLDSHLH\MF
LFLCNLSFANLCFSSVTMPKLLQNMQSQVPSIPYAGCLAQIYFFLYFGDLGNFLLVAMAY
DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAMLHTLLNIKGVR