Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1e20b Olfactory Receptor

Gene Symbol Or1e20b
Organism Rat
Family 1
Subfamily e
Pseudo No
Location chr10:60125767-60126702 (-)
Aliases Olr1474

Sequence information


Nucleotide sequence

ATGGTAATGAACAACCAAACTGTCATCACCCAATTCCTCCTATTGGGACTGCCCATCCCC
CCAGAGCACCAGCAACTGTTCTATGCCCTGTTACTGGCCATGTACCTCACCACTGTCCTG
GGGAACCTCATCATCATCATCCTCATTCACCTGGATTCCCATCTCCACACACCGATGTAC
TTGTTTCTCAGCAACTTATCCTTCTCTGACCTCTGCTTTTCCTCTGTCACGATGCCCAAA
TTGCTGCAGAACATGCAAAGCCAGGATACATCAATCACCTATGTGGGTTGTCTGACACAA
ATGTACTTTTTCCTGCTTTTTGGAAGCCTGGAGATCTTCCTTCTTGTAGTCTTGGCCTAT
GACCGCTATGTGGCCATCTGTTTACCCCTTCAATATTCCAGCATCATGAGTCCCAATCTC
TGTGTGTGTCTGGTAGTACTCTCCTGGGTATTTACTGTATTATACTCCCTGTTGCATACC
CTACTCTTGACTAGACTGTCATTCTGTGAGGATAACTTAATCCGCCACTTTTTCTGTGAC
ATAACTGCCCTGTTTAAGTTGGCCTGCTCTGACATTTATATTAATGAATTAACAGTATTT
ATCTTGGGAGGGCTTGTCAGTGTCACCTCATTCTTACTCATCATTGTATTCTATATACAA
ATTGTCTCCTCAATCTTAAGGATTTCTTCTACTAGGGTAATCCACAAGGTTTTCTCCACC
TGTGGCTCCCACTTATCTGTGGTCTCATTGTTCTATGGGACAATTATTGGTCTGTACTTT
TGTCCATCATCTAATATCTCGACAGTGAAGGAGACCGGAATGGCCCTTATGTACACAGTT
GTGACTCCCATGCTGAACCCCTTCATCTACACCCTGAGAAACAGAGATATGAAAGATGCG
CTGATAAGAGTTCTTTTCAAGAAGAAAATCTCTTTA


Conceptual translation

MVMNNQTVITQFLLLGLPIPPEHQQLFYALLLAMYLTTVLGNLIIIILIHLDSHLHTPMY
LFLSNLSFSDLCFSSVTMPKLLQNMQSQDTSITYVGCLTQMYFFLLFGSLEIFLLVVLAY
DRYVAICLPLQYSSIMSPNLCVCLVVLSWVFTVLYSLLHTLLLTRLSFCEDNLIRHFFCD
ITALFKLACSDIYINELTVFILGGLVSVTSFLLIIVFYIQIVSSILRISSTRVIHKVFST
CGSHLSVVSLFYGTIIGLYFCPSSNISTVKETGMALMYTVVTPMLNPFIYTLRNRDMKDA
LIRVLFKKKISL