Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1e35 Olfactory Receptor

Gene Symbol Or1e35
Organism Mouse
Family 1
Subfamily e
Pseudo No
Location chr11:73906555-73907490 (-)
Aliases Olfr395, RP23-360H16.3, MOR135-10

Sequence information


Nucleotide sequence

ATGGCTGGAAAGAACCAAACTCTCATCTTGGAATTCCTCCTCCTGGGTCTGCCCATCTCA
TCAGAGTATCATCTCCTTTTCTATGCCCTGCTCCTGGCCATGTACCTCACCACTCTCCTG
GGAAACCTGCTAATCATTCTCCTTGTTCGACTGGACTCCCATCTCCACACGCCCATGTAC
TTGTTTCTCAGCAACTTGTCCTTCTCTGATCTCTGCTTTTCCTCTGTCACAATACCTAAA
TTGCTTCAGAACATGCAGAGCCAAGTACCAACGATATCCTATGCAGATTGCCTGACACAG
CTGTACTTCTTTATGGTTTTTGGAGATATGGAGAGCTTCCTTCTTGTGGTCATGGCCTAT
GACCGCTATGTGGCCATCTGCTTTCCTTTGCATTATACCAGCATCATGAGCACCAAATTT
TGTGCTTTACTAGTGCTACTACTGTGGATGCTGACAATATCCCATGCCCTGCTGCATACC
CTACTCATGGCTAGATTGTCTTTTTGTGAGAAGAATGTCATTCTTCACTTTTTCTGTGAT
ATTTCTGCTCTTCTGAAGTTGTCCTGCTCAGACACTTATGTTAATGAGTTGATGATATTT
ATCATGGGAGGGATCATCAGTATTATTCCATTTCTACTCATTGTTATGTCTTATGTAAGG
ATTTTTTTCTCCATTCTCAAGGTTCCATCTTCTCAGGACATCCACAAGGTCTTCTCTACC
TGTGGTTCCCATCTGTCTGTGGTGACCTTGTTTTATGGGACAATTATTGGTCTCTACTTA
TGTCCATCAGGCAATAATTCTACTGTGAATGAGATTTCCATGGCCATGATGTACACAGTG
GTGACTCCCATGCTGAACCCCTTCATCTATAGACTGAGGAATAGAGACATGAAGAGGGCC
CTAATAAGAGTTATCTTCAGTAAGAAAATCTCTCTG


Conceptual translation

MAGKNQTLILEFLLLGLPISSEYHLLFYALLLAMYLTTLLGNLLIILLVRLDSHLHTPMY
LFLSNLSFSDLCFSSVTIPKLLQNMQSQVPTISYADCLTQLYFFMVFGDMESFLLVVMAY
DRYVAICFPLHYTSIMSTKFCALLVLLLWMLTISHALLHTLLMARLSFCEKNVILHFFCD
ISALLKLSCSDTYVNELMIFIMGGIISIIPFLLIVMSYVRIFFSILKVPSSQDIHKVFST
CGSHLSVVTLFYGTIIGLYLCPSGNNSTVNEISMAMMYTVVTPMLNPFIYRLRNRDMKRA
LIRVIFSKKISL