Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1f22-ps Olfactory Receptor

Gene Symbol Or1f22-ps
Organism Rat
Family 1
Subfamily f
Pseudo Yes
Location chr10:12478512-12479672 (-)
Aliases Olr1367-ps

Sequence information


Nucleotide sequence

AAACTCTAATGAAGGATTAATATGAACCTGGTTGTCGCATCCAAACCTGAAGATGTCCTT
CTGAACTTTGCTTCTCCTTTCTGTAGCTAGGCTCAGACTCATGAGCAGCACCAACCAGTC
AAGTGTCTCTGAATTCCTCCTCCTGGGACTCTCCAGGCAGCCCCAGCAGCAGCAGCTCCT
TTTCCTGCTCTTCCTCATAATGTACCTGGCCACTGTCCTGGGAAACATGCCCATCATCCT
GGCCATCAGCACAGACTCCTGCCTGCACACCCCCATGTACTTCTTCCTCAAGATCCTGTC
TTTGCGTATGTCTGCTTCTCCTCTAATACTGTCCCCGAGGTATTGGACAATCACAAACTC
AGGAGTCAAGCATTTCCTTCTCTGGATGTCTCATCCATTTGTATTTTCTCTTTTTATTTA
CTGATATGGACAATTTCCTGCTGGCTGTGATGGCATATGACCAATTTGTGGCCATATGCT
ACCCTTTACACTATATAAGAAATATGACCAATAAGCTCTGTGTCCTGCTTGTTGAGTGGT
CCTGGGTTTTAATGAACCTGAATGCTCTGTTGCACACACTGCTGATGGCTCAACTCTCCT
TTTGTGGGGAAAACATCATCCCTCACTTCTTCTGTGATGCAACTCCCCTCCTGAAACTCT
CCTGCTCAGACATACATCTCAATGACCTGATGATTCTTACAGAGGGAACTACGATTGTAG
TCACCCCATGTTTCTGCATTTTGATCTCCTACATCCACATCATCTGTGCTGTCCCGACAG
TCTCATCCCCTAGAGGAGGATGGAAAGCCTTCTCCACCTGTGTCTCACACCTGGCTGTGT
TCTGCCTCTTCTATGGCACCATCAAATCCCTTTATTTCAACCCCTCATCCTCTCACTTTG
CTGTGAAGGACATGGCAGCTGTCATAATGTACACAGTTGTATCCCCCATGCTGAACCCTT
TCACCTACAGCCTGAAGAACAAGGACATGAAAGGGGCTTTAAGGAAAGTGTTTACCTTGA
ATCTACATCTACCAATAAGGCTAAGAAAATCATATACATAATTAATGGTTTTATTAATCT
ATGGTGTGAAACTTAGAATTTTTGTTAGGAAAGCATCTGATATACCTCTTGGGAGAATAA
AATCCATGTTATAGTCAAGAG


Conceptual translation

MSSTNQSSVSEFLLLGLSRQPQQQQLLFLLFLIMYLATVLGNMPIILAISTDSCLHTPMY
FFLKILSLR/VCFSSNTVPEVLDNHKLRSQ/ISFSGCLIHLYFLFLFTDMDNFLLAVM
AYDQFVAICYPLHYIRNMTNKLCVLLVEWSWVLMNLNALLHTLLMAQLSFCGENIIPHFF
CDATPLLKLSCSDIHLNDLMILTEGTTIVVTPCFCILISYIHIICAVPTVSSPRGGWKAF
STCVSHLAVFCLFYGTIKSLYFNPSSSHFAVKDMAAVIMYTVVSPMLNPFTYSLKNKDMK
GALRKVFTLNLHLP