Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1f27 Olfactory Receptor

Gene Symbol Or1f27
Organism Rat
Family 1
Subfamily f
Pseudo No
Location chr10:12628176-12629114 (-)
Aliases Olr1374

Sequence information


Nucleotide sequence

ATGAGCAGCACCAACCAGTCGAGCATCTCCGAGTTCCTCCTCCTGGGACTCTCCAGGCAG
CCCCAGCAGCAGCAGCTCCTCTTCCTGCTCTTCCTCATCATGTACCTGGCCACTGTCCTG
GGAAATCTGCTCATCATCCTGGCCATCAGCACAGACTCCCGCCTGCACACCCCCATGTAC
TTCTTCCTCAGCAACCTGTCCTTTGTGGATGTCTGCTTCTCCTCCACCACTGTCCCCAAG
GTACTGGCCAACTACATGCTCCGGAGTCAGGCCATTTCCTTCTCTGGATGTCTCACACAG
ATGTATTTTATCTTTAAACTTACAGACATGGACAATTTCCTGCTGGCTGTGATGGCCTAT
GATCGATTTGTGGCCATATGCAATCCTTTACACTACACAACACAGATGACTTATAAGGTC
TGTGTCATGTTAGTGGCTGGATCATGGGTCACTGCCAGCCTGAATGCTCTGTTGCACACT
CTGCTCATGGCTCAACTCTCCTTCTGTGGGGACAACATCATCCCCCACTTCTTCTGTGAT
GTGACTCCTCTCCTTAAACTCTCCTGCTCAGACACACATCTCAATGAGCTGATGATTCTT
ACAGAGGGAGCTGTGATCATGGTCACCCCATTTGTCTGCATCCTCATCTCTTACATCTAT
ATCACTGATGCAATCCTCAGAGTTTCATCCCTTAGGGGAGGACGGAAAGCTTTCTCCACC
TGTGGCTCGCACCTGGCTGTGGTCTGCCTCTTTTATGGCACCATCATCGCTGTTTATTTT
AGCCCCTCATCTGTCCATTCATCTGAAAAGGACACGGCAGCAACTGTGTTGTACACAGTG
GTGACTCCCATGCTGAACCCTTTTATTTATAGCCTAAGGAACAGGGACCTGAAAGGGGCC
CTAAGAAAACTGGTCTCCAGAGGACATTTTTCTGTCCAG


Conceptual translation

MSSTNQSSISEFLLLGLSRQPQQQQLLFLLFLIMYLATVLGNLLIILAISTDSRLHTPMY
FFLSNLSFVDVCFSSTTVPKVLANYMLRSQAISFSGCLTQMYFIFKLTDMDNFLLAVMAY
DRFVAICNPLHYTTQMTYKVCVMLVAGSWVTASLNALLHTLLMAQLSFCGDNIIPHFFCD
VTPLLKLSCSDTHLNELMILTEGAVIMVTPFVCILISYIYITDAILRVSSLRGGRKAFST
CGSHLAVVCLFYGTIIAVYFSPSSVHSSEKDTAATVLYTVVTPMLNPFIYSLRNRDLKGA
LRKLVSRGHFSVQ