Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1f29 Olfactory Receptor

Gene Symbol Or1f29
Organism Rat
Family 1
Subfamily f
Pseudo No
Location chr10:12100088-12101071 (+)
Aliases Olr1358

Sequence information


Nucleotide sequence

ATGGCCTTCCGAACTCTTCTTTGTTCTGTAGCTTGGCTCAGACTCATGAGCAGCACCAAC
CAGTCCAGTGTCACTGAATTTCTCCTCCTGGGACTCTCCAGGCAGCCCCAGCAGCAGCAG
CTCCTCTTCCTGCTCTTCCTCACCATGTACCTGGCCACTATCCTGGGAAACCTGCTCATC
ATCCTGGCCATCGGCACAGACACCCACCTGCACACCCCCATGTACTTCTTCCTCAGCAAT
CTGTCCTTTGTGGATGTCTGCTTCTCCTCCACCACTGTCCCTAAAGTTCTGGCCAACCAT
ATACTTGGGAGTCAGGCCATTTCCTTCTCTGGGTGTCTCACCCAGCTGTATTTTCTCGGT
GTGTTCGGTAACATGGACAATTTCCTGCTGGCTGTGATGTCCTATGACCGATTTGTGGCC
ATATGCCACCCTTTACACTACACAACAAAGATGACCCGTCAGCTCTGTGTCCTGCTTGTT
GTGGGGTCATGGGTTGTAGCCAACATGAATTGTCTGTTGCACATACTGCTCATGGCTCGA
CTCTCCTTCTGTGCAGACAACATGATCCCCCACTTCTTCTGTGATGGAACTCCCCTCCTG
AAACTCTCCTGCTCAGACACACATCTCAATGAGCTGATGATTCTTACAGAGGGAGCTGTG
GTCATGGTCACCCCATTTGTCTGCATCCTCATCTCCTACATCCACATCACCTGTGAGGTC
CTCAGAGTCTCATCCCCCAGGGGAGGATGGAAATCCTTCTCCACCTGTGGCTCCCACCTG
GCTGTGGTCTGCCTCTTCTATGGCACTATCATCGCAGTGTATTTCAACCCATCATCCTCT
CACTTAGCTGGGAGGGACATGGAAGCTGCAGTGATGTATGCAGTGGTGACCCCAATGCTG
AACCCTTTCATCTATAGCCTGAGGAACAGCGACATGAAAGCGGCTTTAAGGAAAGTGCTC
GCCATGAGATTTCCATCTAAGCAG


Conceptual translation

MAFRTLLCSVAWLRLMSSTNQSSVTEFLLLGLSRQPQQQQLLFLLFLTMYLATILGNLLI
ILAIGTDTHLHTPMYFFLSNLSFVDVCFSSTTVPKVLANHILGSQAISFSGCLTQLYFLG
VFGNMDNFLLAVMSYDRFVAICHPLHYTTKMTRQLCVLLVVGSWVVANMNCLLHILLMAR
LSFCADNMIPHFFCDGTPLLKLSCSDTHLNELMILTEGAVVMVTPFVCILISYIHITCEV
LRVSSPRGGWKSFSTCGSHLAVVCLFYGTIIAVYFNPSSSHLAGRDMEAAVMYAVVTPML
NPFIYSLRNSDMKAALRKVLAMRFPSKQ