Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1f35-ps Olfactory Receptor

Gene Symbol Or1f35-ps
Organism Rat
Family 1
Subfamily f
Pseudo Yes
Location chr10:226469-227404 (-)
Aliases Olr1357-ps

Sequence information


Nucleotide sequence

ATGAGCAGCACCAACCAGTCCAGTGTCACCGAGTTCCTCCTCCTGGGACTCTCCAGGCAG
CCCCAGCAGCAGCAGCTCCTCTTCCTGCTCTTCCTCATCATATACCTGGCCACTGTCCTG
GGAAACCTGCTCATCATCCTGGTCATCAGCACAGACTCCCGCCTGCACACCCCCATGTAC
TTCTTCATCATGATCCTGTCCTTTACGGATGTCTGCTTCTCCTCCACCACTGTCCCCAAA
GTATTGGCCAATCACATGCTCAGGAGTCAAACTATTTCCTTCTCTGGGTGTCTCACACAG
TTGTATTTTCTCTGTGTGTTTGCTGATATGGACAATTTCCTGCTGGCTGTGATGGCCTAT
GACTGATTTGTGGCCATATGCCACCCTTTACACTATACAACAAAGATGACCAATAAGTTC
TGTGTCCTTCTTATTGTGGGGTCCTGGGTGTTAACAAACCTGAATGCTCTGTTGCACATA
CTGCTCATGGCTCGACTCTCCTTTTGTGGGGACAACATCATCCCCCACTTCTTCTGTGAT
GCAACTCCCCTCCTGAAACTCTCCTGCTCAGACACACATCTCAATGACCTGATGATTCTT
ACAGAGGGAACTATGATAGTAGTCACCCCATTTTTCTGCATTTTGATCTCCTACATCCAC
ATCACCTGTGCTGTCCTGAGAGTCTCATCCCCTAGAGGAGGATGGAAAGCCTTCTCCACC
TGTGTCTCACACCTGGCTGTGGTCTGCCTCTTCTACAGCACCATCATATCCCTGTATTTC
AACCCCTCATCCTCCTATTTTGCTGGGAAGGACATGGCAGCTGCCATGATGTACACAGTG
GTGACCCCCATGGTGAATCCTTTCATCTACAGCCTGACGAACAGGGACATGAAAGGGGCT
TTAAGGAAAGTATTTACCTTGAATCTACATCTACCA


Conceptual translation

MSSTNQSSVTEFLLLGLSRQPQQQQLLFLLFLIIYLATVLGNLLIILVISTDSRLHTPMY
FFIMILSFTDVCFSSTTVPKVLANHMLRSQTISFSGCLTQLYFLCVFADMDNFLLAVMAY
D*FVAICHPLHYTTKMTNKFCVLLIVGSWVLTNLNALLHILLMARLSFCGDNIIPHFFCD
ATPLLKLSCSDTHLNDLMILTEGTMIVVTPFFCILISYIHITCAVLRVSSPRGGWKAFST
CVSHLAVVCLFYSTIISLYFNPSSSYFAGKDMAAAMMYTVVTPMVNPFIYSLTNRDMKGA
LRKVFTLNLHLP