Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1f38-ps Olfactory Receptor

Gene Symbol Or1f38-ps
Organism Rat
Family 1
Subfamily f
Pseudo Yes
Location chr10:12381954-12382607 (-)
Aliases Olr1363-ps

Sequence information


Nucleotide sequence

TCCATTTCCTTCTCTGGGTGTCTCACACAGATATATTTCTTCTGTGTATTTGCTGATATG
GACAATTTCCTTCTGGCTGTGATGGTCTATGACAGAATTGTGGCCATACACCACCATTTA
CACTACACAATAGACATGACCCATCAGGTCTGTGCCCTTCCTGTTATAGGGTCATGGGTG
GTAGCCAATCTGAATTGTCTGTTGCACATACTGCTCATGGCTCCCCTCTCATTCTGTGCA
GACAACATCATTCCCTACTTCTTCTGTGATGCAATTCCTTTCTTGAAACTCTCCTGCTCA
GACACACATCTCAATGAGTTGATGATTCATACAGAGGGAGCTGTGATCATGGTCACCCCA
TTTGTCTGTATCCTGATCTCCTACATCCACATCACCTGTGCTGTTCTGAGAGTCTCATCC
CCCAGGGGAGGATGGAAAGCCTTCTCCACCTGTGGCTCCCACCTCTTCTATGGCACCATC
ATCGCTGAGTACTTCTCCTCTTCATTCTTTCACTCAGCTGGGAGGGACATAGTAGGTGCC
ATAATGTACACACTGGTGACCCCCATGCTGAACCCTTTCATCTACAGCCTGAGGAGCAGG
GACATGAAAGGAGTTCCAAGGAAAGTGCCTATCCTGAGATTTCCATTCAAGCAG


Conceptual translation

*VLANHLLGIIQ/SISFSGCLTQIYFFCVFADMDNFLLAVMVYDRIVAIHHHLHYTIDM
THQVCALPVIGSWVVANLNCLLHILLMAPLSFCADNIIPYFFCDAIPFLKLSCSDTHLNE
LMIHTEGAVIMVTPFVCILISYIHITCAVLRVSSPRGGWKAFSTCGSHLFYGTIIAEYFS
SSFFHSAGRDIVGAIMYTLVTPMLNPFIYSLRSRDMKGVPRKVPILRFPFKQ