Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1j10 Olfactory Receptor

Gene Symbol Or1j10
Organism Mouse
Family 1
Subfamily j
Pseudo No
Location chr2:36376778-36377695 (+)
Aliases Olfr338, RP23-454A14.8, MOR136-5

Sequence information


Nucleotide sequence

ATGGATAATGAGAGCACTGTGTCTGAGTTCATCCTTCTGGGGCTCCCCATTCGAGCAGAG
GATCAAGCTGTGTACTCTGCCTTGTTCCTGGTTCTGTACCTGACAACTGTGCTGGGGAAC
CTGCTCATCATCCTGCTCATCAGGCTGGACTCTCACCTCCACACCCCCATGTACTTCTTT
CTCAGCCACTTGGCCTTCACTGATATCTCTTTCTCATCAGTCACAGCTCCAAAGATGCTC
GTGAATATGCTGACACACAGTCAGTCCATCTCATATGCTGGGTGTATTTCCCAGGAGTAT
TTTTTCACAGTTTTTGCAGGCATTGATAGCTTTCTTCTGACTTCCATGGCATATGACAGG
TATGTGGCCATCTGCCATCCTCTGCACTATATCACCATCATGAACCAGAACCTCTGTGTC
CTTCTAGTAGTTGTGTCCTGGGCCTTATCTTCTGCAAATTGCCTTGTGCACACCCTTCTC
TTGGCTTGCCTATCTCACTTTAGAAACAATACCATTCCCCATTATTTCTGTGACCTCTCT
ACCTTGCTGAAGCTGTCCAGCTCAGACACCACCATCAATCAACTGGTCATCCTTGTTTTA
GGTAATGTGGTCATTAGCCTGCCATTTATATGTATTCTTGTCTCTTATGGCCGCATTGGA
GTAACCATTATGAAAGCTCCCTCCATCAAGGGAATCTGCAAAGCCTTGTCCACATGTGGC
TCTCACCTCTGTGTGGTTTCCTTGTACTTTGGGTCCATCATTGGACTGTATTGTGTCCCC
TCATCTAATAACATTAATGAGAATAATGCCATTGTGTCTGTGATGTACACTATGGTCACA
CCCATGTTGAATCCCTTTATTTATAGTTTGAGGAATCGGGATATTAAAAGAGCACTGAAA
AATATCCTCAGCAGAAAA


Conceptual translation

MDNESTVSEFILLGLPIRAEDQAVYSALFLVLYLTTVLGNLLIILLIRLDSHLHTPMYFF
LSHLAFTDISFSSVTAPKMLVNMLTHSQSISYAGCISQEYFFTVFAGIDSFLLTSMAYDR
YVAICHPLHYITIMNQNLCVLLVVVSWALSSANCLVHTLLLACLSHFRNNTIPHYFCDLS
TLLKLSSSDTTINQLVILVLGNVVISLPFICILVSYGRIGVTIMKAPSIKGICKALSTCG
SHLCVVSLYFGSIIGLYCVPSSNNINENNAIVSVMYTMVTPMLNPFIYSLRNRDIKRALK
NILSRK