Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1j12 Olfactory Receptor

Gene Symbol Or1j12
Organism Mouse
Family 1
Subfamily j
Pseudo No
Location chr2:36452587-36453522 (+)
Aliases Olfr340, RP23-311F6.2, MGC129200, MOR136-1

Sequence information


Nucleotide sequence

ATGAGGAGAGATAATGAGAGTACTGTGTCTGAATTCATCCTCTTGGGACTCCCCATTCGA
GCAGAGGACCAAGGCCTGTACTCTGCCCTGTTCCTGGCCATGTACCTGACAACTGTGCTG
GGGAACCTGCTCATCATCCTACTCATCAGGCTGGACTCTCACCTCCACACCCCCATGTAC
TTCTTCCTCAGTCACTTGGCCTTCACAGACATCTCTTTCTCATCAGTCGCATCTCCAAAA
ATGGTCATAAATATGCTGACACACAGTCAATCCATCTCATATGCTGGGTGTGTTTCCCAG
GTGTATTTCTTTTCATTTTTTGCTGATCTTGAGAGCTTTCTTCTGACCTCCATGGCCTAT
GACAGGTATGTGGCCATCTGCCACCCTCTGCACTATTCACAAATTATGAGTGAGAACCTC
TGTGTTCTTCTAATAGTAGTATCCTGGACTTTATCTACTGCCAACTCCCTTGTGCACACT
CTTCTCTTGGTACAACTATCTTACTTTAGAAACAATACCATCCCCCACTACTTCTGTGAC
CTGTCTACCTTGCTGAAGCTGTCCAGCTCAGACACTACCATCAATGAGCTTGTCATCCTT
GTTTTAGGTAATATGGTCATTACCCTGCCATTCATATGCATTCTGGTCTCTTATGGCCAC
ATTGGTGTCACCATTATGAAAATTCCCTCCATCAAGGGAATCTGCAAAGCCTTGTCCACA
TGTGGCTCTCACCTCTGTGTGGTTTCCTTGTACTATGGAGCCATCATTGGACTATATTTT
GTCCCCTCATCTAATAACACTAGTGACAAGGATGCCATTGTGGCTATGATGTACACTATG
GTCATACCCATGCTGAATCCCTTTATTTATAGTTTGAGAAATCGGGATATGAAAGGAGCG
CTGAGAAATATCCTCAGCGGGAGACTTTGGTCACAG


Conceptual translation

MRRDNESTVSEFILLGLPIRAEDQGLYSALFLAMYLTTVLGNLLIILLIRLDSHLHTPMY
FFLSHLAFTDISFSSVASPKMVINMLTHSQSISYAGCVSQVYFFSFFADLESFLLTSMAY
DRYVAICHPLHYSQIMSENLCVLLIVVSWTLSTANSLVHTLLLVQLSYFRNNTIPHYFCD
LSTLLKLSSSDTTINELVILVLGNMVITLPFICILVSYGHIGVTIMKIPSIKGICKALST
CGSHLCVVSLYYGAIIGLYFVPSSNNTSDKDAIVAMMYTMVIPMLNPFIYSLRNRDMKGA
LRNILSGRLWSQ