Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1j13 Olfactory Receptor

Gene Symbol Or1j13
Organism Mouse
Family 1
Subfamily j
Pseudo No
Location chr2:36479190-36480128 (-)
Aliases Olfr341, RP23-311F6.3, MOR136-2

Sequence information


Nucleotide sequence

ATGAGGAGAGATAATGAGAGCACTGTGTCTGAGTTCATCCTCCTGGGGCTCCCCATTCAG
CCAGAGGATCAAGGCCTGTATTCTGCTCTGTTCCTGGCCATGTACCTGACAACTGTGCTG
GGGAACCTGCTCATCATCCTGCTCATCAGGCTGGACTCTCACCTCCACACCCCCATGTAT
TTCTTCCTCAGCCACTTGGCCTTCACGGACGTCTCTTTCTCATCAGTCACAGCTCCAAAG
ATGCTCATGAATATGCTGACACACAGTCAGTCCATCTCATATGCTGGTTGTGTTTCTCAG
GTATACTTTTTTTCAACTTTTACTGATCTTGACAGTTTTCTTCTGACCTCCATGGCCTAT
GACAGGTATGTGGCCATCTGCCACCCTCTGCACTATACCACCATCATGAGTCAGAACCTC
TGTGTCCTTTTAGTAGTAATGTCCTGGGTTTTATCCTCTGCCAATGCCCTTGTGCACACC
CTTCTCTTGGCTCGCCTATCTCATTTTAGAAATAATACCATTCCCCACTACTTCTGTGAA
CCCTCTGCCTTATTGAGCCTGTCGAGCTCAGACACCACCATCAATGAGATGGTCATCCTT
CCTTTAGGTACACTAGTCATTACCCTGCCATTCATATGCATCCTGGTCTCTTATGGCCGA
ATTGGAGTCACCATTCTGAGAACTCCGTCCATCAAGGGAATCTGCAAAGCCTTGTCCACG
TGTGGTTCTCACCTCTCTGTTGTTTGTCTGTACTATGGAGCTATTATTGGGCTTTACCTA
GTTCCCTCATCTAATAACACCAATGACAAGGATGTCATTGTGGCTGTGATATATAGTCTG
GTCACACCCATGGTGAATCCCTTTATCTATAGTCTGAGGAATCGGGATATAAAAGGAGCA
TTGAGAAATATCCTCAACAGGAGACTGTGTCCACAGTGG


Conceptual translation

MRRDNESTVSEFILLGLPIQPEDQGLYSALFLAMYLTTVLGNLLIILLIRLDSHLHTPMY
FFLSHLAFTDVSFSSVTAPKMLMNMLTHSQSISYAGCVSQVYFFSTFTDLDSFLLTSMAY
DRYVAICHPLHYTTIMSQNLCVLLVVMSWVLSSANALVHTLLLARLSHFRNNTIPHYFCE
PSALLSLSSSDTTINEMVILPLGTLVITLPFICILVSYGRIGVTILRTPSIKGICKALST
CGSHLSVVCLYYGAIIGLYLVPSSNNTNDKDVIVAVIYSLVTPMVNPFIYSLRNRDIKGA
LRNILNRRLCPQW