Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1j15 Olfactory Receptor

Gene Symbol Or1j15
Organism Mouse
Family 1
Subfamily j
Pseudo No
Location chr2:36568600-36569526 (+)
Aliases Olfr344, RP23-311F6.6, MOR136-12

Sequence information


Nucleotide sequence

ATGAGGATGGATAATAAGAGCACCGTGTCTGAGTTCATCCTCCTGGGGCTCCCCATTCGA
CCAGAGAACCAAGTTATTTACTCTTCCCTGATTCTGACCATGTACCTGACAACTGTGCTG
GGGAACCTGCTCATCATCCTGCTCATCAGGCTGGACCCTCACCTCCACACCCCCATGTAC
TTCTTTCTCAGTCACTTGGCCTTAACAGACATCTCTTTCTCATCAGTCACAGTTCCAAAG
ATGCTGGTGAATATGCTGACACACAGTCAGTCCATTTCATATGATGGGTGTGTTTCCCAG
GTGTATTTTTTCATAGTTTTTGGAAGCATTGATAGCTTTCTTCTGACCTCCATGGCATAT
GACAGGTATGTGGCCTTCTGTCATCCTCTGCATTATACCATCATCATGAATTTGAGCCTC
TGTGTTCTTCTAGTAGGAATGTTCTGGGTCTTATCTTCAGCCAATGCCCTTGTGCAAACC
CTTCTCTTGGCTCGCCTATCTCACTTTAGAAACAACACCATCCCCTACTATTTCTGTGAC
CTCTCTACTTTGCTGAAGCTGTCCAGCTCAGACACCACCATCAATGATCTTATCATCCTT
GTTTTAGGTAATGCAGTCATTACCCTGCCATTCATATGCATTCTTGTCTCTTATGGCTAC
ATTGGTGTCACCATTCTGAAAACTCCCTCCATCAAGGGAATCCGCAAAGCCCTGTCCACA
TGTGGCTCTCACCTCTGTGTGGTATCCTTGTACTATGGATCCATCATTGGACTGTATTGT
GTCCCCTCATCTAATAACACCAGTGAAAAAAATGCCATTGTGGCTGTTATGTACACAGTT
GTCACACCTATGCTGAATCCCTTTATTTATAGCCTAAGGAATCAGGATATGAAAGGAGCA
CTGAGAAATATCCTCAGCAGAACACAA


Conceptual translation

MRMDNKSTVSEFILLGLPIRPENQVIYSSLILTMYLTTVLGNLLIILLIRLDPHLHTPMY
FFLSHLALTDISFSSVTVPKMLVNMLTHSQSISYDGCVSQVYFFIVFGSIDSFLLTSMAY
DRYVAFCHPLHYTIIMNLSLCVLLVGMFWVLSSANALVQTLLLARLSHFRNNTIPYYFCD
LSTLLKLSSSDTTINDLIILVLGNAVITLPFICILVSYGYIGVTILKTPSIKGIRKALST
CGSHLCVVSLYYGSIIGLYCVPSSNNTSEKNAIVAVMYTVVTPMLNPFIYSLRNQDMKGA
LRNILSRTQ