Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1j18 Olfactory Receptor

Gene Symbol Or1j18
Organism Mouse
Family 1
Subfamily j
Pseudo No
Location chr2:36734323-36735258 (+)
Aliases Olfr347, RP23-177C20.1, MOR136-9

Sequence information


Nucleotide sequence

ATGACTGAGGGAAATGAGAGCATTGTGTCTGAGTTCATCCTCTTAGGGCTCCCCATTCAG
CCAGAGGACCAAGACCTGTATTCTGCCTTGTTCCTGGCCATGTACCTGACAACTGTGCTG
GGGAACCTGCTCATCATCCTGCTCATCAGGCTGGACTCTCACCTCCACACCCCCATGTAC
TTTTTCCTCAGTCACTTGGCTTTCACAGACATCTCTTTCTCATCAGTCACAGCTCCAAAG
ATGCTCATGAATATGCTGACACATAGTCAGTCCATCTCATATGCTGGGTGTGTTTTCCAG
GTGTATTTTTTCTTATTTTTTGCTGATCTTGACAACTTCCTTCTGACCTCCATGGCCTAT
GACAGGTATGTGGCCATCTGCCACCCTCTACACTATACCACAATGATGAGTCAGAACCTC
TGTGTTCTTCTAGTAGTTGTGTCCTGGACCTTATCCACTGCCAATGCCCTTGTGCACACC
CTTCTCTTGGCTCGCCTAACTCACTTTAGAGACAATACCATCTCCCACTATTTCTGTGAC
CTGTCTACCTTGCTGAAGCTGTCCAGCTCAGACACCACCACCAACAAGCTGGTTATACTT
CTTTTAGGTAATGTGATCATTACCCTGCCATTTATATGTATACTGGTCTCTTATGGCCTC
ATAGCTGTCACCATTCTGAAAATTCCTTCTATGAAGGGTATCTGCAAAGCCTTGTCCACA
TGTGGCTCTCACCTCTGTGTGGTTTCCTTGTACTATGGAGCCATCATTGGACTATATTTT
GTTCCCTCATCTAATAACACTAATGTACAGGATGCCATTGTGGCTGTGATGTACAATGTG
GTCACACCCATGCTGAATCCCTTTATTTATAGTCTGAGGAATCAGGATATGAAAGGAGCA
CTGAGAAATATCCTCAGCAGGAGACTGTGTTTACAG


Conceptual translation

MTEGNESIVSEFILLGLPIQPEDQDLYSALFLAMYLTTVLGNLLIILLIRLDSHLHTPMY
FFLSHLAFTDISFSSVTAPKMLMNMLTHSQSISYAGCVFQVYFFLFFADLDNFLLTSMAY
DRYVAICHPLHYTTMMSQNLCVLLVVVSWTLSTANALVHTLLLARLTHFRDNTISHYFCD
LSTLLKLSSSDTTTNKLVILLLGNVIITLPFICILVSYGLIAVTILKIPSMKGICKALST
CGSHLCVVSLYYGAIIGLYFVPSSNNTNVQDAIVAVMYNVVTPMLNPFIYSLRNQDMKGA
LRNILSRRLCLQ