Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1j19 Olfactory Receptor

Gene Symbol Or1j19
Organism Rat
Family 1
Subfamily j
Pseudo No
Location chr3:16311578-16312516 (+)
Aliases Olr409

Sequence information


Nucleotide sequence

ATGAAGAGCACAAGGAACCAGAGCAGTGCATTTGAGTTCATCCTCCTGGGGCTCCCCATC
CGACCAGAAGAGCAAGGCATGTACTATGCCATGTTTCTGGCTACATACCTGACCACAGTG
CTGGGGAACCTGCTCATCATTCTGCTCATCAGACTGGATTCTCACCTCCACACTCCCATG
TACTTCTTCCTCAGTCACTTGGCCTTCACGGACATCTCTTTCTCATCAGTCACAGCTCCA
AAGATGCTGATGAATATGTTGATACACAGTCAATCTATCTCATATGCTGGGTGCATTTCC
CAGGCATATTTTTTCTTATTTTTCGCAGATCTTGACAGCTTTCTTCTGACCTCCATGGCC
TATGACAGATATGTGGCCATCTGCCATCCCCTCCACTATACCAGAATCATGAGTCAGAGT
GTCTGTATCTTACTAGTTATTGCATCCTGGTTTTTATCTTTTGCTGGTGCTCTTGTGCAC
ACTCTTCTTCTAGCTCGTCTCTCTTTCTTTAGAGGTAACACTCTCCACCATTTCTTCTGT
GACCTGTCTACCTTAATTAAGCTGTCTAGCTCAGATACATCCATCAATGAGCTGGTCATC
CTTGTTGTAGGATCACTTGTCATTACTGTGCCATTCATATGCATCCTGGTTTCATATGGA
CGCATTGGAGCCACTATCCTGAGAACTCCCTCCATCAAGGGAATCTGCAAAGCCTTGTCC
ACATGTGGCTCTCACCTCTCTGTGGTTTCTCTCTATTACGGAGCAATTATTGGGCTATAT
TTTGTCCCCTCATCAAATGACACTAATGACAAGGATGTCATTGTAGCTGTGATGTACACT
ATGGTCACACCCATGCTGAATCCCTTTATTTACAGTCTGAGGAATCGGGATATGAAAGGA
GCTTTGAGAAATACATTTTCAAGAGCGACTTTTTCCATG


Conceptual translation

MKSTRNQSSAFEFILLGLPIRPEEQGMYYAMFLATYLTTVLGNLLIILLIRLDSHLHTPM
YFFLSHLAFTDISFSSVTAPKMLMNMLIHSQSISYAGCISQAYFFLFFADLDSFLLTSMA
YDRYVAICHPLHYTRIMSQSVCILLVIASWFLSFAGALVHTLLLARLSFFRGNTLHHFFC
DLSTLIKLSSSDTSINELVILVVGSLVITVPFICILVSYGRIGATILRTPSIKGICKALS
TCGSHLSVVSLYYGAIIGLYFVPSSNDTNDKDVIVAVMYTMVTPMLNPFIYSLRNRDMKG
ALRNTFSRATFSM