Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1j24-ps Olfactory Receptor

Gene Symbol Or1j24-ps
Organism Rat
Family 1
Subfamily j
Pseudo Yes
Location chr3:16163324-16164444 (+)
Aliases Olr405-ps

Sequence information


Nucleotide sequence

TTCCTAAATGTTCCCACAGTGCATTAGTCAAAATCACTTCTCTTTCTTTCTCATTTCTCC
TTTTACTCACAGCAGAAGAGCAAGAGCATGAGGTGGAATGATGAGAGCATCCTCCTGGAG
ATCCCCAATTCAAACAGAGGAACAAGATGTGTACTCTGCCCTGGTCCTGGTCATGTACCT
GACAACTATGCTGGAGAACCTGTTCATCGTCCTGCTCATCAGATTGGATTCTCACATCCA
AACATGCATGTACTTCTTTGTTAGTCACTTGGTCTTTATGAGCATCTCTTTCTCATCAGT
CACACAGCTCCAAAAATGCTCAGAAACATGCTGACATTTAGTCAGTCCATCTCATATTCT
GTATGCATTTCCCAGGTGTATTTTTTAGTTTTTTGAAGTATTTAATGCTATCTTCTGGCC
TCCATGGTGTATGACTGGTTTGTGGCCAACTGCCACCATGAGCCTAAGCCTGTGTTCTTC
TAGTAGCAATTTCCTGAGCCTTACCTTTAGCCAATGCTCTGTGCACACCCTTCTCTTGGC
TAGGCTATCTCACTTTAGAAACAATGCCATCCCATACTACTACTGTGACCTCTCTACCTT
GAAGCTGTCCAGCTCAGATACCACAATCAATAAGCTGGTAATTATTCTTTTAGGTATTAT
GGTCATTTTCCTGCCATTCATAGGCAACCTTCTCTCTTATGGCCAAATGGGAGTCACCAT
TCTGAAAACTTCCTCTATCAAGAGAATCTTCAAAGTGTTGTCTACATGTGGTTCTCACTT
ATGTGGACTCTCTTTGTACTATGAGCCATTATTGGCCTGTACTTTGTTCCCTCATCTAAT
ACCACAAATAAGAAAGATTTTTTTGTGTTGGTGATGTACACTTTGCTCACATTCATGCTA
AATTCATTTATTTAAAGTCTGAGGAATCGAGCAAAATATGAAAACAGCACTGAAAAATAT
ACTCAGCAGAACAAATGGTGCACTTTCTGTTTCCCATTATCTGTCTAGGATTCCTATTTG
ATTGAAACATGTAATATTTTCTCTCTGAATGGCCATCTTAAACTGAATTTCTTGCATATA
CCTTAGATGGTACACTTACCTCAGTTTAGTTCTCTTGATCC


Conceptual translation

MRWNDESILL\SPIQTEEQDVYSALVLVMYLTTMLENLFIVLLIRLDSHIQTCMYFFVS
HLVFMSISFSSVT/APKMLRNMLTFSQSISYSVCISQVYFLVF*SI*CYLLASMVYDWF
VANCHHEPK/CVLLVAIS/SLTFSQCSVHTLLLARLSHFRNNAIPYYYCDLSTLKLSS
SDTTINKLVIILLGIMVIFLPFIGNLLSYGQMGVTILKTSSIKRIFKVLSTCGSHLCGLS
LYY/AIIGLYFVPSSNTTNKKDFFVLVMYTLLTFMLNSFI*SLRNR\NMKTALKNILS
RTNGALSV