Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1j8-ps Olfactory Receptor

Gene Symbol Or1j8-ps
Organism Rat
Family 1
Subfamily j
Pseudo Yes
Location chr3:15643829-15644963 (+)
Aliases Olr394-ps

Sequence information


Nucleotide sequence

GAGGACTTTCATCTAAAGCAAAGAAGAATCATACAGGAAGGATAGTTGCAGTAATGTGAT
GGCCACGCTCACTGGTGTTTTATTGTTTCTAACTCTCAGCATGAGGAGGGAGAACCAGAG
TACTGTGTTCGAGTTCCTCCTCCTGGGGCTCCCCATCAGACCAGAGCATCAGAATGTCTT
CTTCACTTTGTTCCTGGCCATGTACCTGACCACAGTGTTGGGGAACCTGCTCATCATCCT
GCTCATCAGGCTGGACTCTCACCTCCACACCCCCATGTACTTCTTCCTCAGCCACTTGGC
CTTCACAGACATCTCCCTTTCATCCGTTACAGTCCCTAAAATGCTGATGAATATCCAGGC
TCAGCAACATTCCATCTCCTACAAGGGCTGCATCTCTCAGATGTATTTTTTTGTTCTGTT
TGGCTGGACAATTTCCTTCTTGCAGTGATGGCCTATGACAGATATGTGGCCATCTGTCAT
CCACTGCACTACATCACTGTCATGAGGGAGGAGCTCTGTGTCTGTCTAGTTGCTGCATCC
TGGTTCTTCTGCTGTGTCCATGCCCTGCTGCACACCCTCCTTTTGATCCAACTGTCCTTC
TGTGCCAGTAATGCCATACACAACTTCTTCTGTGACCTCACTGCCCTCCTGAAGCTGAGC
TGCTCGGACATCTCCCTCAATAAGCTAGTCATCTTCACTGAAGGAGGCTTACTTTTCATC
CTGCCTCTGAGTAGCATCATGGGCTCATATATTCTCATAGGATGCACTGCCTTGAAGCCT
CCCTCCACAAAGAAATTCATTAAAACCTTTTCTACTTGTGGCTCCCATCTCCTTGTGGTA
TCTTTGTACTATGGGACACTTGCAGGTGAATACTTTTTCTCTTCATTCCAGAATTCCAGC
GACAAAGACACAGTTGCTTCTGTAATTTATACAGTGGTCACACCCTTGCTGAACCCTTTC
ATCTACAGCCTGAGGAACAGAGATATAAAACAGGCTCTAGAAATAGTAGTCACTAGGATC
AGCTGCTTTAAGTGAGAGATATTCAACCCACTTATTTTGAACACTTAGTTGTATATTTCC
TAAAATTATGATATACATATTTCTTGTATTTAGTATAATACAATTATATATATAT


Conceptual translation

MRRENQSTVFEFLLLGLPIRPEHQNVFFTLFLAMYLTTVLGNLLIILLIRLDSHLHTPMY
FFLSHLAFTDISLSSVTVPKMLMNIQAQQHSISYKGCISQMYFFVLF/LDNFLLAVMAY
DRYVAICHPLHYITVMREELCVCLVAASWFFCCVHALLHTLLLIQLSFCASNAIHNFFCD
LTALLKLSCSDISLNKLVIFTEGGLLFILPLSSIMGSYILIGCTALKPPSTKKFIKTFST
CGSHLLVVSLYYGTLAGEYFFSSFQNSSDKDTVASVIYTVVTPLLNPFIYSLRNRDIKQA
LEIVVTRISCFK