Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1j8 Olfactory Receptor

Gene Symbol Or1j8
Organism Mouse
Family 1
Subfamily j
Pseudo No
Location chr2:36301628-36302476 (+)
Aliases Olfr335, RP23-454A14.4, MOR137-2

Sequence information


Nucleotide sequence

ATGTTCCTGGCCATGTACCTGACCACAGTGCTGGGAAACCTGCTCATCATCTTGCTCATC
AGGCTGGACCCTCACCTCCACACTCCCATGTACTTCTTCCTCAGCCACTTGGCCTTCTCT
GACATCTCTCTTTCATCCATTACAGTTCCCAAAATGCTGATGAATATTCAGGCTCAGCAC
CATTCCATCTCTTACAAGGGATGCATCTCTCAGATGTATTTTTTTATTCTGTTTGTCTGC
CTGGACAATTTCCTTCTTGCAGCGATGGCCTATGACAGGTATGTGGCCATCTGTCATCCT
CTGCACTATATCACTGTCATGAGGGAGGAGCTCTGTGTCTGCCTAGTCGCTGGGTCCTGG
TTCTTCAGCTGTGTCCACGCCCTGCTGCACACCCTCCTCTTGATCCAACTGTCCTTCTGT
GCCAGTAATACTGTCCCCAACTTCTTCTGTGACCTCACTGCCCTCCTGAAGCTGAGCTGC
TCAGACATCTCCCTCAATAAGCTAGTCATCTTCACTGAGGGAGGATTACTTTTCATCCTG
CCTCTGAGTAGCATCATGGGCTCTTATATTCTCATAGGAAGAACTGCCTTGAAGGCCCCC
TCCACAAAGAGATTCATTAAAACCTTTTCTACCTGTGGCTCCCATCTCCTTGTGGTGTCT
TTGTACTATGGGACACTTGCAGGTGAATACTTTTTCTCTTCATTCCAGAACTCCAGTGAC
AAAGACATAGTGGCTTCTGTAATTTATACAGTAGTCACACCCTTGCTGAACCCTTTCATC
TACAGCCTGAGGAACAGTGATATAAAACAGGCTCTAGAAATTGTTGTCACTAAGATCAAC
TGCTTTAAG


Conceptual translation

MFLAMYLTTVLGNLLIILLIRLDPHLHTPMYFFLSHLAFSDISLSSITVPKMLMNIQAQH
HSISYKGCISQMYFFILFVCLDNFLLAAMAYDRYVAICHPLHYITVMREELCVCLVAGSW
FFSCVHALLHTLLLIQLSFCASNTVPNFFCDLTALLKLSCSDISLNKLVIFTEGGLLFIL
PLSSIMGSYILIGRTALKAPSTKRFIKTFSTCGSHLLVVSLYYGTLAGEYFFSSFQNSSD
KDIVASVIYTVVTPLLNPFIYSLRNSDIKQALEIVVTKINCFK