Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1o1 Olfactory Receptor

Gene Symbol Or1o1
Organism Rat
Family 1
Subfamily o
Pseudo No
Location chr20:1,515,460-1,516,390 (-)
Aliases Olr1718

Sequence information


Conceptual translation

MNCTQSPGFILLGLSSDPEKWQLFFSIFLALYLLGFLGNLLLLLAIGADVHLHTPMYFFL
SQLSLXLCFITTTAPKMLEALWTGDGSISFSGCLTQMCLFGVFADMDNLLLAVMAIDRY
AAICQPLLYPLLMTPCRCGVLACGSWGIAHCASLVYTLLLSQLSFHSNQEIPHFFCDSRP
LLWLSCSDTHLNEFLMMVLSALLGISALLCIVSSYGCIFCAVARVPSAKGRRKALATCSS
HLSVVLLFYSTVFATYLKPPSTSHSSGEVVAAVMYTLITPTLNPFIYSLRNKDVKNSLKK
LLNMEKPLD