Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or1u2-ps Olfactory Receptor

Gene Symbol Or1u2-ps
Organism Rat
Family 1
Subfamily u
Pseudo Yes
Location chr3:15617755-15618818 (+)
Aliases Olr393-ps

Sequence information


Nucleotide sequence

CCCCTGAGAGGAAACATGTGGTCTGTCGTGGCAATTGGGTGAGGAGTTCAGGTCTCTGAT
TATTTCTTTCTCTTTCACTTACAACAGAGATGACAGCAGCATGAGGAGGGAGAGCTAGAG
CACTGTGTTTGAACTCCTGCTGGGGCTCCCATCAGACCAGAACAGCAGAACATTTTCTTC
ACCCTGTTACTGGCCGTATACCTGATAGCTGTGCTCTGGAATCTGCTCCTCATCCTGCTC
ATTAGGCTGGATTCCTGTCTCCACACCCTCATGTACTTCTTCCTCATCATCCTGCACACC
ATGCTGAACTCTCACCTCCAACCTCCCATGTATTTCTTCCTTAGCCTTCTTTCTCTTCAG
TTACCATCTCAGGGATGCCCTGGAGCACTCAGAGTCAGCACCTAAGGATTCCCTATGAGG
GGTGTTTCTCAAATCTATTTTTCTTACATTTTCTATGTGTTGACAACTTGCTTCTTGAAG
TGATGGCTTATGACAGGCATTTGTCCATCTAACAAACACTGTATTACATCATTATGATGG
GGGAGGAGCTGTATGGCTTCTTGGTGGCTGGGTGTTGCTTCATTTCTTGTATACATGCCC
TGTTGTATATTCCTTCCTCTACCTATCCATCCCTTACCATTTCTGTTATCTCAATGAGCC
TTTGAAGCTGTCTTGACTAAACACCCCCTTCAATGAGCTAGTGATCTCTACTGAGGGAGG
TGTTGACTTCACTGGGCACCATTTCGGGATCTTATGTCTGTACTGGGGCTACTGTCTTGG
TGGTGTCCCTTCACCAAGAATATCTGCAAAGTTCTTTCTGGTGCATTCACACTGTAGGAT
ACTTGCAATTATTTATTTCTTTCATTTCTCAAGTAACTCCAAATTTAAGGATGCGATTGC
TTCAGCTACTTACACAGTGGTGACACCCATGCTGAATCCCTTCATCTACAGCATAGAAAT
ATAAAAATTGGCCCATGGACCATTCTGTAGAACAGGAATTAGCTTTGTCAAGTGAGAGTT
ATCTACTCAAGTTATGTTTTTCCTTTCTTTCTCATCTTTAAAAT


Conceptual translation

MRRES*STVFELLLGL/IRPEQQNIFFTLLLAVYLIAVLWNLLLILLIRLDSCLHTLMY
FFLIILHTMLNSHLQPPMYFFLS/SFSSVTISGMPWSTQSQHLRIPYEGCFSNLFFLHF
LCVDNLLLEVMAYDRHLSI*QTLYYIIMMGEELYGFLVAGCCFISCIHALLYIPSS/LS
IPYHFCYLNEPLKLS*LNTPFNELVISTEGGVDFTGHHFGILCLYWGYCLGGVPSPRISA
KFFLVHSHCRILAIIYFFHFSSNSKFKDAIASATYTVVTPMLNPFIYSIEI