Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or1v1-ps Olfactory Receptor

Gene Symbol Or1v1-ps
Organism Mouse
Family 1
Subfamily v
Pseudo Yes
Location chr2:36844548-36845114 (+)
Aliases Olfr349-ps1, MOR136-17P

Sequence information


Nucleotide sequence

ATGATGTATGTCCACTATATCTCCACTACATTAGTATCATGAGAAAAGAGCTTGGTGCAT
TATTAGAAGCTGTTTTTTGGATCTTGTACAATGCCAGCTCCTTCACTTGCGTCTTCTAAC
ATTGTTGCTCTTCTGTGCTGATGGCATGCTTCTGTTAAGACCTAACTGCCATGATCAAAT
TATCCTGCTTAGATACCTTCCTAAAAGAATTGGTCATGTTCACAGTCAGGGTGGCAGTCA
TTATTTGGCATTTATATGTACATTGGTATCTTATGGATACACTGGGGCCACAGTCCTGAG
GGGCCCTTCGACCATGGGGATTTATAAAGCATTGTATACACATGGCTTCTACCTCTTGGT
GGTGTCTTTATATTATGGGGGTATTTTGGATAGTACCTTTTCCCAGAATTAAGCAATAGG
ATGGACAAGGACACCATTATAGCTGTCATGTAAACAGCTGTCACACCCATGTTAAATCTC
TTCATTTGTAATCTAAGAAATAGGGATACAAAAGAAGCACTAGGGATACTCTTGTCAAGT
AAGAGGTTTTACATGATAACATCTGAA


Conceptual translation

MMYVHY/LHYISIMRKELGALLEAVFWILY/CQLLHLRLLTLLLFCADGM\C*DLTA
MIKLSCLDTFLKELVMFTVRVAVIIW/FICTLVSYGYTGATVLRGPSTMGIYKALYTHG
FYLLVVSLYYGGI/G*YLFPELSNRMDKDTIIAVM*TAVTPMLNLFICNLRNRDTKEAL
GILLSSKRFYMITSE